KEGG   Hirschia baltica: Hbal_1410Help
Entry
Hbal_1410         CDS       T00945                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
hba  Hirschia baltica
Brite
Enzymes [BR:hba01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Hbal_1410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(1474555..1475145)
Genome map
AA seq 196 aa AA seqDB search
MAFELPALPYATDALEPHMSANTFSFHHAKHHNAYVTNLNKMIEGTDFAGKSLEEIIKSS
DGGVFNNAAQVWNHTFFWHSMKPQGGGEPTGAIADKINADFGSYAAFKEAFATAGATQFG
SGWAWLVLANGKLEVRKTPNAETPLTEDGVTPLLTMDVWEHAYYLDYQNARPVYIETFLS
ELVNWDFVNQNLADAS
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaacttcctgcactcccatacgcaacagatgcactagaacctcacatgtct
gcgaacacttttagctttcaccacgcaaagcatcacaacgcatatgtgacaaatttgaat
aagatgattgaaggcactgacttcgcaggcaaatcacttgaagaaatcatcaagtcttct
gatggcggtgtatttaacaatgcggctcaagtgtggaaccacacattcttctggcactca
atgaaaccacaaggtggcggcgagccaactggtgcgatcgccgacaagatcaatgcagat
tttgggtcttatgctgcatttaaagaagctttcgctacagctggtgcgactcaatttggt
tctggttgggcttggcttgtccttgcaaacggcaaactagaagtgcgcaaaactccaaat
gctgaaacacctcttacagaagacggtgtaacaccgcttctaaccatggatgtttgggag
cacgcatattacctagattaccagaacgcacgtccagtttacattgaaacctttcttagc
gaactcgtgaattgggacttcgtaaaccagaacttggcagacgctagctag

DBGET integrated database retrieval system