KEGG   Hahella chejuensis: HCH_00952Help
Entry
HCH_00952         CDS       T00307                                 

Gene name
maiA
Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01801  
maleylpyruvate isomerase [EC:5.2.1.4]
Organism
hch  Hahella chejuensis
Pathway
Tyrosine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    HCH_00952 (maiA)
Enzymes [BR:hch01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.4  maleylpyruvate isomerase
     HCH_00952 (maiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(946422..947069)
Genome map
AA seq 215 aa AA seqDB search
MMLLYDYWRSSAAYRVRIALNLKGLPYEAHSVHLVKDGGQQHQSDYRALNPQGLVPLLTD
GSFRLNQSLAIIEYLEDTHPSPALLPADPQSKAQVRAFSQVIACDIHPLDNLRVLQYLTG
PMEVSEERKLVWYQHWILEGFKALEKMAASYADAGPYCFGEQVTMADVCLIPQVYNADRF
NCPMTDFPRLREINDNCLKLEAFQKATPEQQADAT
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgatgctcttatatgattactggcgctccagcgccgcctaccgggtgcgtatcgcactg
aacctgaaaggacttccttacgaagcccacagcgttcacctggtgaaagacggcggccaa
cagcaccagtctgactacagggccctgaatcctcagggcctcgtcccgctgctgacggac
ggctcgttccgcctgaatcagtctcttgcgattatcgagtatctggaagatacgcatcca
tcgcctgctttacttccagcagatccgcaaagtaaagcgcaagtcagggctttcagtcag
gtcattgcttgtgacattcacccgttggataacctgcgggtgttgcagtatctgaccggc
cccatggaagtcagcgaggagaggaagctggtgtggtatcagcattggattcttgagggc
ttcaaggcgcttgagaaaatggcggcgagttatgcggatgcaggtccctactgctttggc
gagcaggtgacgatggcggatgtctgcctgattcctcaggtatacaacgccgaccgtttc
aactgcccgatgacggactttccgagactacgggagatcaacgacaattgcctgaagctg
gaagccttccagaaggcgacgcctgaacaacaggcggacgcgacttag

DBGET integrated database retrieval system