KEGG   Hahella chejuensis: HCH_06219Help
Entry
HCH_06219         CDS       T00307                                 

Gene name
tuf1
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
hch  Hahella chejuensis
Brite
Translation factors [BR:hch03012]
 Eukaryotic Type
  Elongation factors
   HCH_06219 (tuf1)
 Prokaryotic Type
   HCH_06219 (tuf1)
Mitochondrial biogenesis [BR:hch03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    HCH_06219 (tuf1)
Exosome [BR:hch04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HCH_06219 (tuf1)
  Exosomal proteins of breast cancer cells
   HCH_06219 (tuf1)
  Exosomal proteins of colorectal cancer cells
   HCH_06219 (tuf1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(6345646..6346839)
Genome map
AA seq 397 aa AA seqDB search
MAKEKFERSKPHVNVGTIGHVDHGKTTLTAALTRVCSEVWGGQAVAFDGIDNAPEEKARG
ITIATSHVEYESPIRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIVVFLNKADMVDDEELLELVEMEVRDLLSQYEFPGDDTPIIVGSALLALE
GKDDNGMGTSAVKKLVETLDAYIPEPERAIDKPFLMPIEDVFSISGRGTVVTGRVERGIV
RVGEEVEIVGIKDTTKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDDVERGQVLAKPG
TITPHTVFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGACELPEGVEMVMPGDNV
KMKVSLIAPIAMEEGLRFAIREGGRTVGAGVVAKIFE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaagaaaagtttgaacgcagcaagccgcacgtaaacgtaggcaccattggtcac
gttgaccacggtaagactactttgacagcggccttgacccgcgtatgttctgaagtttgg
ggtggtcaggcggtagcgtttgacggtatcgataatgctccagaggaaaaggcgcgtggt
atcactatcgcgacttctcacgttgagtacgaatctcccattcgtcactatgcgcacgtt
gactgccctgggcacgctgactatgtgaagaacatgatcactggtgcggcgcagatggat
ggcgctattttggtgtgttccgcagctgacggccctatgcctcagactcgtgagcacatc
ctgctggcgcgtcaggttggtgttccttacatcgtcgtgttcctgaacaaagcggacatg
gttgatgatgaagagctgttggaattggttgagatggaagttcgcgacctgctgagccag
tacgaattcccaggcgacgacactccaattatcgttggttccgcgttgttggcgttggaa
ggtaaggacgataacggtatgggtactagcgctgttaagaagctggttgagactctggat
gcttacatcccagagcctgagcgcgccattgataagccgttcctgatgccgatcgaagac
gtattctctatctctggtcgcggcacagttgtaactggtcgtgtagagcgcggcattgtc
agggttggtgaggaagttgagattgttggtatcaaagatactaccaagactacctgtact
ggcgttgagatgttccgtaagctgctggacgaaggtcgtgcaggtgagaacgttggagtg
ttgttgcgcggcactaagcgtgatgatgtagagcgtggtcaggtactggccaagccagga
actattactccgcacaccgtttttgaatcagaagtatacgtactgagcaaagacgagggt
ggccgtcatactcctttcttcaagggctatcgtcctcagttctacttccgtacaacggat
gtgactggtgcgtgtgagttgccagaaggcgtagagatggttatgccgggcgacaacgta
aaaatgaaagtcagccttatcgctccgatcgcgatggaagaggggctgcgctttgcgatt
cgtgaaggcggccgtacagtgggcgctggcgttgttgctaaaattttcgagtaa

DBGET integrated database retrieval system