KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_3150Help
Entry
Hden_3150         CDS       T01265                                 

Definition
(GenBank) putative phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Hden_3150
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Hden_3150
   00680 Methane metabolism
    Hden_3150
Enzymes [BR:hdn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Hden_3150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(3218417..3221272)
Genome map
AA seq 951 aa AA seqDB search
MQDTTRVEHSAELDELALIEELKRLRTQIPDNPSLNPILNVAFDLSRRLESQAITFDAVK
NLAGRLMDRACVRRARRLRDKVGYVDQATTLKDFTAYVEKTANEAAGSIEAFAQRWSRAR
TGIVMTAHPTFGLSDALYRRMVEIAVADPSAKEVQIGIPHRPEETLTLRHEHKCVQEAIR
NLRNAYEELLHAFFSVSSQKFGEAAFKLRPKLATMASWVGYDLDGRNDISWTFSFHVRLL
EKRAALADIRERFVVLKHKLDDADGPQRIARQIVGKLDLGIAAVDEQIKAIEQFENDHDY
LTKAANVITKSDGYNLLTVEPLQTLFEQLIDSVEAPQVKRAIAALSGLVAATGLGTSHIH
LRINALQLNNAFRAYVHEPWTRDLTERQSLARIVDMIKNCPQETVNFSTLDLETATAIRQ
FALTAQIQKHVDRETPIRFLIAEAESPATILIAVFFAKLFGVDHITDISPLFETPSGLEN
GARIMERLVEEDTYRDYVQGRKRLSIQTGFSDAGRFIGQIPATLAIERYYDSLSALVAKA
KLQNVETLIFSTHGESMGRGAHPGDLHQRLHYLMTDESRRRFADAKIPVKHETSFQGGDG
YMTFGNRALTTRALATVVMDGEIPEETIDPFYTEQNFNLDFFLRLRAFQQKLFAHDGYRA
VLGAFGANLLFKTGSRPVKRQGEHTSDRGNPARMRAIPNNAILQQFGYLANVVAGLGIAV
GSEVDHFNKLARSSKRLQSMLAMVAHAKTISSLNAMGANAKIFDAGFWAARASWGREQAL
NSAFRTLATHLLPDDRESDIAELVHLLRLDAIDLHAILTDLNIEDGMTPDENRLELDLLQ
AIRLAVMMRIFILAAQLPRFTPQDGLSHTQVLEMALGLDIPDVLAVLRKAFPHSNRKIDE
KDEFNEPASYRPRGVNDYGRLETEILTPMENSYEFVREIGTGISHHFGAFG
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatacgacgcgcgtggaacattcagctgaactcgacgaactcgcgctgatcgaa
gagttgaagcgtctgaggacgcaaatcccggacaatccctcgctcaatcctattctcaac
gtcgcctttgatctgtcgcggcgtcttgaatcgcaggcgatcaccttcgacgccgtcaag
aatctcgccggccgcctgatggaccgcgcctgcgtgcgccgcgcccggcggctgcgcgac
aaggtcggctacgtcgaccaggcgacgacgctgaaagattttactgcctacgtcgaaaag
acggcgaacgaagccgcaggctcgattgaagccttcgcgcagcgctggtcgcgcgcgcgc
accggcatcgtcatgaccgcgcatccgacctttggactctccgatgcgctctatcgccgg
atggtcgaaatcgccgtcgccgacccgtcagccaaagaagttcagatcggcattccgcat
cgccccgaggaaacgctgacgctgcggcacgagcacaagtgcgtgcaggaggcgatccgc
aatctgcgcaacgcttatgaagagctgctgcatgcgttcttcagcgtctcgtcgcagaag
ttcggcgaggccgcattcaagctgcgcccgaagctcgcgacgatggcgtcctgggtcggc
tacgacctcgacggccgcaatgatatttcctggacgttctcgttccacgtgcgcctgctc
gaaaagcgcgccgctctcgccgacattcgcgagcgcttcgtcgtcctgaagcacaagctc
gacgacgccgacggcccgcagcgcatcgcacgccagatcgtcggcaagctcgatctcggc
attgccgcggtcgacgagcagatcaaggcgatcgagcagttcgagaacgaccacgactat
ctcacgaaagcggcgaacgtcatcaccaagtccgacggctataacctgctgacggtcgag
ccgctgcagacgctgttcgaacagctgatcgattccgtcgaagctccgcaggtgaagcgc
gctatcgctgcgctctcgggcctcgtcgccgcgaccgggctcggcacgtcgcacattcac
cttcgcatcaacgcgctgcaattgaacaacgccttccgcgcttacgtccacgagccctgg
acgcgcgatctgaccgagcgtcagtcgctggcgcgcattgtcgatatgatcaagaattgc
ccgcaggaaacggtcaacttctcgacactcgatctcgagaccgcgacggcgatacgtcag
ttcgcattgaccgcgcaaatccagaagcatgtcgaccgcgaaacgccgatccgcttcctg
atcgccgaggcggaatcgcccgcaacgatcctgatcgcggttttctttgcgaagctcttc
ggcgtcgatcacatcaccgatatttcgccgctgttcgaaacgccgtcgggcctcgagaac
ggcgcgcgcatcatggagcgcctcgtcgaagaggacacctatcgcgattacgttcagggc
cggaagcgtctgagcatccagaccggcttctcggatgccggccgcttcatcggccaaatt
ccggcgacgctggcgatcgagcgctactacgacagtctgtcggcgctggtcgcgaaggcg
aagctgcagaacgtcgagacgctgatcttctcgacgcacggcgagtcgatggggcgcggt
gcgcatccgggcgacctgcatcagcgcctgcactatctgatgacggacgagtcgcgccgc
cgcttcgccgacgccaaaattccggtgaagcacgaaacgagcttccagggcggcgacggt
tacatgaccttcggcaatcgggccttgaccacccgcgctttggcgaccgtcgtcatggac
ggcgagatcccggaagagacgatcgatccgttctataccgagcagaatttcaacctcgac
ttcttccttcgcctgcgcgcattccagcagaagctgttcgctcacgacggctatcgtgcc
gtgctcggcgcgttcggcgcgaacctgctattcaagaccggatcgcggccggtgaagcgc
cagggcgagcatacgtccgatcgtggcaacccggcgcgcatgcgcgcgatcccgaacaat
gcgatcctgcagcagttcggatatctcgcgaacgtcgtcgcgggtctcggtatcgccgtc
ggcagcgaggtcgatcacttcaacaagctcgcccgttcgtcgaagcgcctgcagtcgatg
ctggcgatggtcgcgcacgccaagaccatctcgagcctcaacgcgatgggcgccaacgcc
aagattttcgacgcggggttctgggcggcgcgcgcctcatggggccgcgagcaggctttg
aactctgcgttccgcacgctggcgacgcatctcttgcccgacgatcgcgaaagcgacatc
gccgagctcgtgcatcttctgcgtctcgatgcgatcgatcttcatgccatcctcaccgac
ctcaacatcgaggacggcatgacgccggacgagaaccgtctggaactcgatcttctgcaa
gctattcgtcttgcggtgatgatgcgcatctttatcctcgcggcgcagctcccgcgcttc
accccgcaggatggcctgtcgcatacgcaggttctcgaaatggcgctcggcctcgatatt
cccgacgtgctcgcggtgttgcgcaaggccttcccgcactcgaaccgcaagatcgacgag
aaggacgagttcaacgagccggcaagctatcgtccgcgcggtgtgaacgactatggacgt
ctcgaaaccgaaatcctgacgccgatggaaaattcgtacgagttcgtgcgtgagatcggc
accggcatctcgcatcacttcggcgccttcggctga

DBGET integrated database retrieval system