KEGG   Heterocephalus glaber (naked mole rat): 101701835Help
Entry
101701835         CDS       T02812                                 

Gene name
Ace
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Renin-angiotensin system
Renin secretion
Chagas disease (American trypanosomiasis)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    101701835 (Ace)
   04614 Renin-angiotensin system
    101701835 (Ace)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    101701835 (Ace)
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    101701835 (Ace)
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     101701835 (Ace)
Peptidases [BR:hgl01002]
 Metallo Peptidases
  Family M2
   101701835 (Ace)
Exosome [BR:hgl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101701835 (Ace)
CD molecules [BR:hgl04090]
 Proteins
  101701835 (Ace)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1305 aa AA seqDB search
MDEADSSEAESPRVAAPTARGWAATVFTEGSPLCSGVLLFRQPLNYLQKGSPCHHPTSLL
VPFLPHSFPGARFLSCSSSLSSWYPQEEAALLSQEFAEAWGQTAKELYEPVWQNFTDPEL
RRVIGAVRTLGPANLPLAKRQQYNSLLSNMSRIYSTGKVCFPNKTATCWSLDPELTNILA
SSRNYAMLLFSWEGWHNAVGIPLKPLYQDFTTLSNEAYKQDGFSDTGAYWRSWYDSPTFE
KDLEHLYHQLEPLYLNLHAYVRRALHRHYGDKYINLRGPIPAHLLGNMWAQSWENLYNMV
VPFPDKPNLDVTSAMVEKGWNATHMFRVAEEFFTSLGLSPMPPEFWAESMLEKPSDGREV
VCHASAWDFYNRKDFRIKQCTRVTMDQLFTVHHEMGHVQYYLQYKDLPVSLRRGANPGFH
EAIGDVLALSVSTPAHLHKIGLLDHVTNDSESDINYLLKMALEKIAFLPFGYLVDQWRWE
VFSGRTPPSRYNFDWWYLRTKYQGICPPVVRNETHFDAGAKFHVPSVTPYIRYFVSFVLQ
FQFHQALCKEAGHQGPLHQCDIYQSSQAGAKLREVLQAGCSRPWQEVLKDLVGSDALDAQ
PLLNYFQPVSKWLQEQNQRNDEVLGWPEYQWRPPLPNNYPEGIDLVTDEAEANKFVEEYD
RTSQVVWNEYSEANWNYNTNITAEASKVLLQKNVEVANHTLKYGTWAKQFDVSNFQNATT
KRIIKKVQDLDRAALPTQELEEYNQILLNMETTYSVANVCHTNGTCLHLEPDLTNVMATS
RKYEELLWVWKSWRDKVGRAILPFFPKYVALSNKAARLNGYMDAGDSWRSMYETPSLEQD
LERLFQELQPLYLNLHAYVRRALHRHYGPECINLEGPIPAHLLGNMWAQTWSNIYDLVVP
FPSAPKMDATEAMIKQGWTPRRMFKEADDFFISLGLLPVPPEFWNKSMLEKPTDGREVVC
HASAWDFYNGKDFRIKQCTTVNMEELVVAHHEMGHIQYFMQYKDLPLAFREGANPGFHEA
IGDVLALSVSTPKHLHSLNLLSSEGGSYEHDINFLMKMALDKIAFIPFSYLIDQWRWRVF
DGSITKDNYNQEWWSLRLKYQGLCPPVPRSQDDFDPGAKFHVPSSVPYIRYFVSFIIQFQ
FHEALCQAAGHQGPLHKCDIYQSKEAGKLLGNTMKLGFSKPWPEAMKVITGQPNMSALAM
MNYFKPLMDWLTTENGRHGEKLGWPKYNWTPNSARSENSFSDSGRVNFLGMNLEPHQARM
GQWVLLFLGVALLVATLGLTQRLFSIRHHSLRQPQFGSEVELRHS
NT seq 3918 nt NT seq  +upstreamnt  +downstreamnt
atggacgaggctgactcctccgaggctgagtccccccgggtggcggcgcccacggctcgg
ggctgggcagcgacagttttcacagagggctccccgctctgctctggagtcctcctcttc
aggcagccgcttaactacctccagaaggggtcaccttgccatcatcccacctcccttctg
gtcccatttctgccccatagcttccccggagccagattcctgagctgttcatcctccctc
tcctcctggtacccgcaggaggaagcagccctgctcagccaagagtttgcggaggcctgg
ggccagacggctaaggaactgtatgagccagtctggcagaacttcactgacccagagctt
cgcagggttattggagcagtgcgcaccctgggtcctgccaacctgcccctggccaagcgg
cagcagtacaactctctgctgagcaacatgagcaggatctactccacaggcaaggtctgc
ttccccaacaagactgccacctgctggtccctggacccagagctcaccaacattttggct
tcttcaagaaactatgccatgctgctgttttcctgggagggctggcacaatgctgtgggc
atcccgctgaaacccctgtaccaggacttcactaccctcagcaatgaggcctacaaacag
gatggcttctcagacacaggggcttattggcgttcatggtacgactcaccaacctttgag
aaagacctggagcacctctaccaccaattagagcccctctacctgaacctccatgcctat
gtccgccgtgcactacaccgccactatggggacaagtatatcaacctcagggggccaatc
cctgcccaccttctgggaaacatgtgggcacagagctgggagaacctctacaacatggtg
gtacctttcccagacaagcccaacctcgacgtcaccagtgctatggtggagaagggctgg
aatgctacacacatgttccgggtggcagaggagttcttcacctccctggggctctcacct
atgcctcctgagttttgggcagagtcgatgctggagaagccatctgacgggcgggaggtg
gtgtgccacgcctcagcctgggacttctacaacaggaaggacttcaggatcaagcagtgc
acaagggtcacaatggaccagctcttcacagtccaccacgaaatgggccacgtgcagtac
tacctacagtacaaggacctgcccgtgtccctgcgcagaggtgccaaccctggcttccac
gaggccatcggggatgtgctggcactctcagtctccactcctgcacatctgcacaaaatt
ggcctgctggaccatgtcaccaatgactcagaaagtgacatcaattacttgctaaagatg
gccctggaaaaaattgccttcctgccctttggctacttggtggaccagtggcgttgggag
gtcttcagtgggcgtactcccccttcacgatacaactttgactggtggtatcttcgaacc
aagtatcaggggatctgtcctccagtggtccgaaatgaaacccactttgatgctggagct
aaatttcatgtccccagtgtgacaccatacatcaggtactttgtgagctttgtcctgcag
ttccagtttcaccaagccctgtgcaaggaggcaggccaccagggaccgctgcaccaatgt
gacatctaccagtcttcccaggcaggggccaagcttcgggaggtgctgcaggcaggctgc
tccaggccctggcaggaggtgctgaaggacctggtgggctcagatgccttggatgctcag
ccactgctcaattacttccagccagtcagcaagtggctacaggagcagaaccagcggaac
gacgaggtcctgggctggccagaatatcagtggcgcccaccattgcccaacaactaccca
gaaggcattgacctggtaactgatgaggctgaggctaacaagttcgtggaggaatatgac
cggacatctcaggtggtgtggaatgaatactccgaagccaactggaactacaacaccaac
atcactgccgaagccagcaaggtcctgctgcagaagaacgtggaagtggccaaccataca
ctgaagtatggcacctgggccaagcagtttgacgttagcaacttccagaatgccaccacc
aaacggatcataaagaaagttcaagacctggatcgggcagcgctccctacccaggagctg
gaagagtataaccagattctgctgaacatggaaactacttacagcgtggccaacgtgtgc
cataccaatggcacttgtctacatttggagcctgatctgacaaatgtgatggccacttcc
cggaaatatgaagaactgctctgggtgtggaagagctggcgagacaaggtgggaagagcc
atcctccctttcttcccaaagtatgtggcactgagtaacaaggctgcccggctcaatggc
tacatggatgcaggggactcatggagatccatgtatgagacgccatccctggagcaagac
ctggagaggctcttccaggagctgcagccgctctacctgaacctgcatgcctatgtgcgc
cgtgccctgcaccgccactatgggcctgagtgcatcaacctggagggtcccattcctgcc
catctgctggggaacatgtgggcacagacctggtccaacatctatgacttggtggtgccc
ttcccttcagcccccaagatggatgccacagaggccatgataaagcagggctggacaccc
agaaggatgtttaaagaagctgatgatttcttcatctccctggggttgctgcctgtgccc
cctgagttctggaacaagtcaatgctggagaagccaacggatgggcgtgaggtggtatgc
catgcctcagcctgggacttctacaatggcaaggacttcaggatcaagcagtgcaccact
gtgaacatggaggagctggtggtggcccaccacgaaatgggccacatccagtatttcatg
cagtacaaggatttgcccttagcctttcgggagggtgccaaccctggctttcacgaggcc
attggggacgtgctggctctctcagtgtctacccccaagcatctacacagcctcaacctg
ctgagtagtgagggcggcagctatgagcacgacatcaactttctaatgaagatggcactc
gacaagatcgcctttattcccttcagctacctcattgaccagtggcgctggagggtattt
gatggaagcatcaccaaggacaactataatcaggagtggtggagcctcaggctgaagtac
cagggtctctgccccccagtgcccaggtcccaagatgactttgatccaggagccaagttc
cacgttccttcaagtgtaccttatatcaggtactttgtcagcttcattatccagttccag
ttccatgaggcactgtgccaggctgctggccaccaggggccactgcataaatgtgacatc
taccagtccaaggaagcagggaagctcctagggaacaccatgaagctgggcttcagtaaa
ccatggccagaagccatgaaggtgatcacaggtcagcccaacatgtcagccctggccatg
atgaactacttcaagccactgatggactggctcaccactgaaaacgggcggcatggggag
aagctgggctggccgaagtacaactggacaccaaactctgctcgctcagaaaactccttc
tcagactccggccgtgtcaacttcttgggcatgaatctggagccacaccaggcccgcatg
ggtcagtgggtgctgctcttcctgggcgtggccctattggtggccaccttgggcctcacc
caacggctcttcagcatccgccaccacagtctccgccagccccagtttggctctgaggtg
gagctgagacactcctga

DBGET integrated database retrieval system