KEGG   Heterocephalus glaber (naked mole rat): 101720615Help
Entry
101720615         CDS       T02812                                 

Gene name
Tgm5
Definition
(RefSeq) transglutaminase 5
  KO
K05622  
transglutaminase 5 [EC:2.3.2.13]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
Enzymes [BR:hgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101720615 (Tgm5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 735 aa AA seqDB search
MAQGLDPAPQSHCLAWLITGLEVALTDLRSSWNNVYHHTDDVSVDRLLVRRGQAFSIILY
FRNRGFQPGLDNIIFVVETGPLPDLAKGTRAVFGLGNQGGPGPWIALPEAPGPTSLEVSL
CAPPMAAVGRYLLKVHISSFQGSVTAYKLGEFILLFNPWCPGDAVYLDSEPQRQEYVVND
YGFIYQGSKNWIRPCPWNYGQFEENIIDICLELLDKSLNFQTDPATDCALRGSPVYVSRV
VCTMINSNDDNGVLNGNWSENYVDGINPAEWTGSVAILKQWHAAGCQPVRYGQCWVFAAV
MCTVMRCLGIPTRVITNFDSGHDTDGNLIIDEYYDNTGRILENKKKDTVWNFHVWNECWM
ARKDLPPGYGGWQVLDATPQETSNGLYCCGPASVRAIKEGEVDLKYDTPFVFSMVNADCM
SWLIYGGKEQKLHQDTTSVGNFISTKSIQSDERDDITESYKYGEGSPQERLVFQKALQKL
KSERSHGTLRADSQPSRPLSRSWDSPRSLDTPSLRPSDVVQVSLKFELLDPPNMGQDINF
VLMALNMSSQFKDLRVNLSAQSLLHDGSPLPTFWQDKAFITLSPEEERTYPCKIPYAQYS
QYLSTDKLIRISALGEEKSSPEKILVNKIITLTYPGITINVLGAATVNQPLSIQVIFSNP
LSEPVEDCVLTLEGSGLFKKQQRVLIGVLKPHHRATITLKTVPFKSGPRQIQANLRSNKF
KDIKGYRNINVDFAL
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaggactggaccctgctccacaatcccattgtcttgcctggctcatcacaggg
ctggaggtggccctcacagatctccggagctcctggaacaatgtgtaccaccacaccgat
gacgtcagtgtggaccgcctccttgtccgcagaggccaggccttcagcatcatcctgtac
ttcagaaaccgcggctttcagccaggcctggacaacatcatctttgtggttgagactgga
cccctgccagacctggccaaagggacacgggcagtgttcggcttgggaaaccagggtggc
cccggcccctggatcgccttgccggaggcccccgggcccacctccctggaagtgagcctg
tgtgcgccccctatggcagctgtgggtcggtacctgctgaaagttcacatcagttccttc
cagggatccgtcacagcctacaagcttggggagttcatcctgctcttcaatccctggtgc
ccaggggatgccgtctacttggacagtgagccccagagacaggaatacgttgtgaacgat
tatggcttcatctaccaggggagcaagaactggatccgcccgtgcccgtggaactatggg
cagtttgaagaaaatattatagacatctgcctagagctgctggacaagagcctgaacttc
cagactgacccagccacagactgtgccctgcggggaagccctgtctacgtcagcagagtg
gtgtgcaccatgatcaacagtaatgatgacaatggggtgctcaatggaaactggagcgag
aattatgtagacggcatcaaccctgccgagtggaccggcagcgtggccatcctaaagcag
tggcatgctgctggctgccaaccagtgcgctatgggcagtgctgggtctttgccgccgtc
atgtgcacagtgatgcggtgcctggggatccccacccgcgtgatcaccaactttgactct
ggccacgacactgacggcaacctgatcatagatgagtattacgacaacacaggcaggatt
ttggagaacaagaagaaggatactgtctggaacttccacgtctggaatgagtgctggatg
gcccggaaggatctcccccctggatatggaggctggcaggtgctggatgccacccctcag
gagaccagcaatggcctctactgctgcggccctgcctccgtcagagctatcaaagaaggg
gaagtggatctgaaatatgacacacccttcgtgttctccatggtgaatgctgactgcatg
tcctggctcatctacggagggaaggagcagaagcttcaccaggacaccacttctgttggc
aatttcattagcactaagagcatccagagtgatgagcgagatgacatcaccgagagctac
aagtatggagaaggttcaccccaagagaggctcgtgtttcagaaagccctacagaagctg
aagtctgagaggtcccatggtaccctccgagctgactcacaaccctccaggcccttgtca
cggagctgggacagccctcggagcctggatacaccttcccttcgacctagtgatgttgtc
caagtttctctgaaattcgagctacttgacccacccaacatgggccaggacataaacttt
gtcctgatggctctcaacatgtcatcccagttcaaggatctcagagtgaacctgagcgct
cagtcactgctgcatgatggcagccccctacccactttctggcaggacaaagctttcatc
accctgtctcctgaagaagagaggacctacccctgcaaaatcccctacgcccaatacagc
cagtacctgtcaacagacaagctaattcgcatcagtgccctgggtgaagagaagagcagc
cctgagaaaatcctggtgaacaagatcatcaccctgacttatccaggcatcacgattaat
gttttaggagcagctaccgtgaaccagcctctctccatacaagtgatattttcaaacccc
ctctcagagcctgttgaggactgtgtgctgaccttggaaggaagtggcctctttaagaag
cagcagagagtcctcattggagtcctcaaaccccaccacagagccaccatcactctgaag
actgtccccttcaagagtggcccaaggcagatccaggctaacctaagaagcaacaagttt
aaggacatcaaaggctacaggaatattaatgtagacttcgcattataa

DBGET integrated database retrieval system