KEGG   Halorhodospira halophila: Hhal_2291Help
Entry
Hhal_2291         CDS       T00462                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
hha  Halorhodospira halophila
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hha00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Hhal_2291
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Hhal_2291
   00680 Methane metabolism
    Hhal_2291
Enzymes [BR:hha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Hhal_2291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2515225..2517876
Genome map
AA seq 883 aa AA seqDB search
MEEHQDSDSALREDIRDLGELLGATLREQGGTELFETVERVRVLAKTARAGDDQAAQELE
RTLSELPPEQVTPVARAFSQFLNLANIAEQHHRVRRSREWARTPEAQPLFGSLAETVPRL
AADMEPEQLHEAICSMDINLVFTAHPTEVQRRTMLQKYNRIAGLLDNRDRFGQTPTEVAE
TRLALKREITAAWHSDEIRRRRPTPQDEARWGLAVVEQTLWDAVPRYLRSLDHTLREHTG
RPLPLDCAPITFGSWMGGDRDGNPNVTHRVTRDVAILSRWMAAYLYERDIQRLVSTLSLQ
VCDDELRDEVGGEAWEPYRVVLKRLRARLRQTMRWAEAKLQGGRPPESDILTEVEDLRQP
LLRCYYSLQRVGAGVVAEGELLDTIRRVSCFGLTLMPMDIRQHADRHTAALDAITQAVGL
GSYSEWDEETRQQWLFQELSHRRPLIPLDFKPEREVQEVLDTIHMLEEIGPDAVGAYIVS
HASKPSDILAVELLQKECGLTHPTRVVPLFETRDTLARAADTMEVLFKSDWYRQRIGGRQ
EIMIGYSDSTKDAGHLTATWTLYQAQEQLVALSRRQRVDLTLFHGRGGSIGRGGGPTHAA
ILAQPPGSVDGTLRVTEQGEVMQAKFGLPGIALRNLELYTTSVLEATVRPPEPPPKRWRE
ILERLSDRAMTAYRQTVKERPEFMDYFQAATPIDEISRLTIGSRPAKRAPDQMTVDSLRA
IPWVFAWTQTRLMLPAWLGVGEALEEAIEEGLTEELQEMFARWPFFEAFLDMVEMVVAKA
EPGVNRLYEHALVPDELHSVGDELRDRFARTRDAVLTVTGHEEPLSDFPVVKRAVEVRNP
YVDPLNLLQVELLRRSRMCEDDSLRRGLQVVINGIAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggaagagcatcaggatagcgacagcgccctgcgcgaagacatccgggacctcggcgag
ctcctcggtgccaccctgcgcgagcagggcggcaccgagctcttcgagaccgtcgagcgg
gtccgggtgctggccaagacggcccgcgccggggacgaccaagctgcgcaggagctcgaa
cgaaccctttcggaactgccgcccgaacaagtcacgccggtggctcgggccttctcgcag
ttcctcaacctggccaatatcgctgagcagcaccaccgggtccgccgcagccgcgagtgg
gcccgcacccccgaggcacaaccgctgttcggctccctggccgagaccgtcccccggctg
gccgcagatatggagcccgaacaactccatgaggccatctgcagcatggacatcaacctg
gtcttcaccgctcaccccaccgaggtgcagcgacggaccatgctgcagaagtacaaccgc
atcgccgggttgttggacaaccgcgaccgcttcgggcagacgcccacggaggtggccgag
acccgtctggcgctcaagcgggagatcaccgcggcctggcacagcgacgagatccggcgc
cgccgccccaccccccaggatgaggcacgctggggcctggcggtggtggagcagacgcta
tgggacgcggtgccacgctacctgcgcagcctcgaccacaccctgcgcgagcacaccggt
cgccccctgcccctggactgcgcccccatcaccttcggctcctggatgggcggcgaccgc
gacggcaaccccaatgtgacccaccgggtcacccgggacgtcgccatcctgtcgcgctgg
atggccgcctacctctacgagcgggacatccagcgactggtctccaccctgtcgctgcag
gtctgcgacgacgagctgcgcgatgaggtcggcggcgaggcgtgggaaccctaccgcgtg
gtgctcaagcgactgcgggcgcggctgcgccagaccatgcgctgggccgaggccaagctc
caaggcggacgaccgccggagagcgacatcctcaccgaggtcgaggacctgcgccagccg
ctgctgcgctgctattactccctgcagcgggtcggcgccggcgtggtcgccgagggcgag
ttgctggataccatccgccgtgtgagctgcttcggcctcaccctgatgcccatggacatc
cgccagcatgcggatcgccacaccgcggcactcgacgccatcacccaggcggtgggcctg
ggcagctactccgagtgggacgaggagacccggcagcagtggctgttccaggagctctcc
caccgccggccgctgatcccgctggacttcaagcccgagcgcgaggtccaggaggtgctc
gacaccatccacatgctcgaggagatcggccccgacgccgtgggcgcgtatatcgtctcc
cacgcctcgaagccctccgacatcctcgccgtggagctgctgcagaaggagtgcgggctc
acccaccccacccgggtggtccccctgttcgagacccgcgacacgctggccagggcggcc
gacaccatggaggtactgttcaagagcgactggtaccgccagcgcatcggcggccgccaa
gagatcatgatcggctactccgactccaccaaggacgccggtcacctcaccgccacctgg
acgctgtatcaggcccaggagcagctggtggccctctcccgccggcagcgcgtcgacctg
accctgttccacggccgcggcggcagcatcggccgcggtggcggccccacccacgccgcc
atcctggcccagccgccaggctccgtcgacgggaccctgcgcgtcaccgagcagggcgag
gtgatgcaggccaagttcggcctgccggggatcgccctgcggaacctggagctctatacc
acctcggtcctggaggcgaccgtccgcccgccggagccaccgcccaagcgctggcgcgag
atcctggagcggctcagcgaccgggccatgacggcctatcggcagaccgtcaaggagcgc
ccggagttcatggactacttccaggcggccacccccatcgacgagatctcgcggttgacc
atcggcagccggccggccaagcgcgccccggaccagatgacggtggacagcctgcgcgcc
atcccctgggtcttcgcctggacacagacccggttgatgctccccgcctggctgggggtc
ggcgaggccctggaggaggccatcgaggaggggctcaccgaagagctccaggagatgttc
gcccgctggccgttcttcgaggccttcctcgacatggtggagatggtggtggccaaggcg
gagcccggcgtcaaccgcctctatgagcacgccctggtccccgatgagctgcacagcgtc
ggcgatgaactgcgcgatcgcttcgcccgcacccgggacgccgtactcacggtcaccgga
cacgaggagccgctgtcggacttcccggtggtcaagcgcgccgtggaggttcgtaaccct
tacgtcgatccgctcaacctgctgcaggtggagctgctacgccgctcccggatgtgcgag
gacgactccctgcgccgcggcctgcaggtggtcatcaacgggatcgccgcgggaatgcgc
aacacgggatag

DBGET integrated database retrieval system