KEGG   Halorhodospira halochloris: M911_13230Help
Entry
M911_13230        CDS       T03059                                 

Gene name
rbcL
Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
hhc  Halorhodospira halochloris
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:hhc00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    M911_13230 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    M911_13230 (rbcL)
Enzymes [BR:hhc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     M911_13230 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2738889..2740301
Genome map
AA seq 470 aa AA seqDB search
MSKTYDAGVKEYRDMYWTPDYVPLDTDLLACFKVTGQPGVPREEVAAAVAAESSTGTWST
VWSELLTDLEFYKGRAYRIEDVPGDKESFYTFIAYPIDLFEEGSIVNVLTSLVGNVFGFK
ALRHLRLEDIRFPIAYVKTCMGPPSGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRA
VYECLRGGLDFTKDDENVNSQPFMRWQNRFEFVAEAVAASQQETGERKGHYLNVTAPDPE
EMYARAEFAKELGQPIIMHDYITGGFCANTGLAKWCRKNGMLLHIHRAMHAVIDRHPKHG
IHFRVLAKCLRLSGGDHLHTGTVVGKLEGDRGSTLGFVDLLRESFIPEDRSRGIFFDQDW
GSLPGVFAVASGGIHVWHMPALVTIFGDDSVLQFGGGTQGHPWGNAAGAAANRVALEACV
KARNEGREIEKEARDVLSEAARHSPELAIAMETWKEIKFEFETVDKLDQG
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagacgtacgacgcgggcgttaaagaataccgagacatgtactggacgccggac
tatgtccccctggacacggacctgctggcctgtttcaaggtgaccggccagcccggcgtg
ccgcgggaagaagtggccgctgcggtggcggcagagtcctccaccggcacctggagtacc
gtatggtcggagctgctcaccgatctggaattctacaagggccgcgcctatcgcatcgag
gacgtgcctggcgacaaggagtccttctataccttcatcgcctatcccatagatctgttc
gaggaaggctccatcgtcaacgtgctcacctccctggtgggtaacgtgttcgggttcaag
gcgctgcgtcacctgcgactggaggatatccgcttccccatcgcctacgtcaagacctgc
atggggccgcccagcggtatccaggtggagcgggacaagctcaacaagtatggtcgtccc
ctgctgggctgcaccatcaagcccaagctgggactctccgccaagaactacggccgtgcc
gtttacgagtgcctgcgcggcggtctggacttcaccaaggacgacgaaaacgtgaactcg
cagccgttcatgcgctggcaaaaccgcttcgagttcgtggccgaggcggtggcagcctct
cagcaggagaccggtgaacgcaaggggcattacctgaacgtgaccgcccccgatccggaa
gagatgtatgcccgggccgaattcgccaaggaactgggccagcccatcatcatgcacgac
tacatcaccggcggcttctgtgccaacaccggtctggccaagtggtgccgcaagaacggc
atgctgttgcacatccaccgggccatgcacgccgtcatcgatcgtcatcccaagcacggc
attcacttccgcgtactggccaagtgccttcgcctctctggcggcgaccacctgcacacc
ggcaccgtggtgggcaagctggagggggatcgaggctccaccctgggcttcgtggacctg
ctgcgtgagtccttcatcccggaagaccgctcccggggcatcttcttcgaccaggactgg
ggctcgctgcccggcgtcttcgccgtggcatccggcggcatccatgtgtggcacatgccg
gccctggtcaccatctttggcgacgactcggtgctgcagttcggaggcggcacgcagggt
cacccctggggcaacgccgccggcgctgctgccaacagggtggcgctggaggcctgcgtc
aaggcccgcaacgaaggccgggagatcgagaaggaggcccgcgatgtgctcagcgaggcg
gcccgccacagtccggaactggccatcgccatggaaacctggaaagagatcaagttcgag
ttcgagaccgtggacaagctggaccagggctga

DBGET integrated database retrieval system