KEGG   Herbaspirillum hiltneri: F506_12900Help
Entry
F506_12900        CDS       T04039                                 

Definition
(GenBank) DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
hht  Herbaspirillum hiltneri
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:hht00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    F506_12900
Enzymes [BR:hht01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     F506_12900
DNA repair and recombination proteins [BR:hht03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     F506_12900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2835863..2838421
Genome map
AA seq 852 aa AA seqDB search
MSLARYRAKRDFRITPEPPPATRRSGKMLSYFIQRHHARALHYDFRLEVGGVLKSWAVPK
GPSLDPHDKRLAVHVEDHPYDYGSFEGRIPEHQYGAGEVVLWDRGEWLPIGDPVAGLKKG
HLEFELRGVKLNGRWNLVRMGKPAEKDSKSKENWLLIKEKDDAAREGKQADITGLRPESV
ADALPPKAVKPAAKAAETTPKNRRNAHRAAMPAKLDVQLATLAEHAPDGDEWLSEMKFDG
YRGLCRIEGGEARIFTREHLDWSKRWPQLTQALAALDVDEAWIDGEVVALLEGGSISFEA
LQDQAGYGGVTLALYVFDLLWLNGEDLRDTPLLERKRRLREVVPGVDGSGLIRFSEHIVG
DAAEVYRHACLHGMEGTVVKRIDAAYAGRRDRSWLKLKCALRQEFVIAGYTDPAGSRVGF
GALLVGVHDAATGELHYAGRVGTGFDDRNLAQLLKRFKTLERDQPAFVDPPRGRLAHGVH
WLAPKLVAEVKFAQWTKSGILRHGAFVALREDKKAGDIVRERKDATPDVPDAPDATAASG
KSCKSAKAGSAGGVIAGVRLTHPDKLLFTDPHLSKRDLAEYYASIADWLLPHVQRRPMTM
VRCPDGSAGKCFFQRHLGQGAPDAVEKIEVPEGKGSADYMMVNDVAGLVATVQMGVLELH
TWGSREGKLTQPDRVVFDLDPAPDVPWGKVVDGARLVHGLLEEIGLRSFVKTSGGKGLHV
VVPIVPEQDWDVVKEWSRSLATHMAEVLPDYFTAKMAKVARNGKIYIDYLRNGIGATTVA
AYSPRARPGAPVSVPLTWDELSARTKADSFNVATVPKRLASLKRDPWHDYAGTKQRLTKK
ILSLFPTEEESA
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atgagcctggcccgctatcgcgccaagcgtgatttcaggatcacgcccgagccgccgccg
gccacgcgccggtccggcaagatgctcagctacttcattcagcgccatcacgcccgcgct
ttgcactacgacttccgcctcgaagtgggcggcgtgctcaaaagctgggcggtgccgaaa
ggtcccagcctggacccgcacgacaagcgcctggcggtgcacgtggaagaccatccctac
gactacggcagttttgaaggccgcattcccgagcaccagtacggcgccggcgaagtggtc
ctgtgggatcgcggggaatggctgccgatcggcgatccggtggccggcttgaaaaaagga
cacctggaattcgagctgcgcggcgtcaaactgaacgggcgctggaacctggtgcgcatg
ggcaagcccgcagaaaaagacagcaagagcaaggaaaactggctgttgatcaaggaaaag
gacgacgccgcacgcgaaggcaaacaggccgacatcaccggcttgcggccggaaagcgta
gcggatgcactgcctcccaaggccgtaaaacctgcagccaaggcggctgaaacaacgccg
aaaaaccgccggaacgcacatcgcgccgccatgccggccaagctcgacgtccagctggcg
acgctggccgaacacgcacccgacggcgacgaatggctcagcgaaatgaagttcgacggc
tatcgcgggttgtgccgcatcgagggcggcgaggcgcgcatctttacgcgcgagcatctc
gactggagcaagcgctggccgcaactgacccaggcgctggccgcgcttgacgtcgatgaa
gcctggatcgacggggaagtggtggcattgctggagggcggcagcatcagtttcgaagcc
ttgcaggaccaggccggctatggcggagtaacgttggccctgtacgtgttcgacctgctg
tggctcaacggcgaggacttgcgcgacacgccgctgctggagcgcaagcgccggctgcgc
gaagtggtgccgggggtggacggcagcgggctgatccgtttcagcgaacatatcgtcggc
gacgccgccgaagtctatcgccacgcctgcctgcacggcatggagggtaccgtggtcaag
cgcatcgatgccgcctatgcggggcggcgcgaccgcagctggctcaagctcaagtgcgcg
ctgcgccaggaattcgtcatcgccggctataccgatccggccggcagccgagtcggcttc
ggcgctttgctggtgggcgtgcatgatgcagcaaccggagagttgcactacgccggacgc
gtcggaaccggcttcgacgaccgcaatctggcgcaactgctcaagcgcttcaaaaccctg
gagcgcgatcagccggccttcgtcgatccgccgcgcggccggctggcgcatggcgtgcac
tggctggcgccgaagctggtggcggaggtgaagttcgcgcagtggaccaaatccggcatc
ctgcgtcacggcgcgttcgtggcgttgcgcgaggacaagaaggccggcgacatcgtgcgc
gagaggaaggacgctacgcctgatgttcctgatgctcctgatgcgacggcagcgtcagga
aaatcctgcaaatccgcgaaggccggatctgcaggcggcgttatcgcaggcgtgcgcctc
acccatcccgacaagttgctgttcactgatccgcacctgagcaaacgcgatctcgccgaa
tactacgccagcatcgccgactggctgctgccacacgtgcagcgacgcccgatgaccatg
gtgcgctgtcccgacggcagtgccggcaagtgcttcttccagcgccatctgggccaggga
gcgcctgacgccgtggagaagatcgaggtcccggaaggcaagggcagcgccgactacatg
atggtcaacgatgttgccggactggtcgctaccgtccagatgggcgtattggaactgcat
acctggggctcgcgcgagggcaagctgacgcaaccggaccgggtcgtcttcgatctcgat
ccggcgccggacgtcccgtggggcaaggtggttgacggcgcccggctggtgcacggcttg
ctggaagaaatcggcttgcgcagtttcgtcaagacctcgggcggcaagggcttgcacgtg
gtcgtaccgatcgtgccggaacaggactgggatgttgtcaaggaatggtcgcgtagcctc
gccacgcacatggcggaagtactgccggattacttcactgcaaagatggcgaaggtggcg
cgcaacggcaagatctacatcgattacctgcgcaacgggataggagccaccaccgtcgcc
gcgtattcgccgcgagcgcggccgggagcaccggtgtcggtaccgctgacctgggatgaa
ttgagcgccaggacaaaggcagacagcttcaatgtcgccaccgtgccgaaacggctggcc
tcgctcaagcgcgatccctggcatgactatgccggtacgaaacagcgcctaaccaagaag
attttgtcgttgttccctactgaagaggagtcagcatga

DBGET integrated database retrieval system