KEGG   Herbaspirillum hiltneri: F506_22120Help
Entry
F506_22120        CDS       T04039                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
hht  Herbaspirillum hiltneri
Pathway
hht00020  Citrate cycle (TCA cycle)
hht00480  Glutathione metabolism
hht01100  Metabolic pathways
hht01110  Biosynthesis of secondary metabolites
hht01120  Microbial metabolism in diverse environments
hht01130  Biosynthesis of antibiotics
hht01200  Carbon metabolism
hht01210  2-Oxocarboxylic acid metabolism
hht01230  Biosynthesis of amino acids
Module
hht_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hht_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:hht00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    F506_22120
  Metabolism of other amino acids
   00480 Glutathione metabolism
    F506_22120
Enzymes [BR:hht01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     F506_22120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH B12-binding_2
Motif
Other DBs
NCBI-ProteinID: AKZ64993
UniProt: A0A0K2BII8
LinkDB All DBs
Position
complement(4882769..4885003)
Genome map
AA seq 744 aa AA seqDB search
MTTDNSTIIYTLTDEAPLLATYSLLPIIRTFTAPAGVNVVESDISVATRILAEFPDRLTP
EQRVPDNLAALGQLTQDPNANIIKLPNISASVPQLQAAIRELQSRGYAIPDLPEDPKTDE
EKEILKSYSKVLGSAVNPVLREGNSDRRAPASIKRFARKHPHSMGEWSMASRSHVAHMKH
GDFYHGEKSMTIGAARDVKMELVGKSGKTTVLKPKVALKAGEIIDSMFMSKKALCEFYEE
QFEDARKTGVMLSLHVKATMMKVSHPIVFGHAVKIFYKEAFAKHGKLFDELGVNVNNGLV
NLYEKIESLPSSKKEEIIRDLHACHEHRPSLAMVDSAKGISNLHAPNDVIVDASMPAMIR
IGGKMWDANGKPQDTKAVIPESTFARIYQEVINFCKTNGNFDPTTMGTVPNVGLMAQKAE
EYGSHDKTFEIAEDGVANIVDLATGEVLLTQNVEQGDIWRMCQVKDEPIRDWVKLAVTRA
RNSGMPAVFWLDPYRPHEAELIKKVETYLKDHDTKGLDIQIMSQVRAMRYTLERVIRGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVKQLVEEN
HLRWDSLGEFLALAVSLEDMGIKTGNKKAQVLGKALDDATGKLLDNNKSPSPKTGELDNR
GSHFYLAMYWAQELAAQKEDAELAAKFAPLAKTLTENEAKITAELKAVQGNPVDIGGYFL
ADPKKVSAVMRPSATLNAALASVK
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
gtgactactgataattccaccatcatctatacgctgactgatgaggcgccactgctggcg
acctactctctgctgcccatcatcaggacgttcaccgcgccggccggcgtcaacgtcgtt
gaaagcgatatctcggtggccacgcggattctggccgaattcccggaccgtctgacacct
gaacagcgtgtcccggacaatctcgccgcgctgggccagctgacccaggacccgaacgcc
aacatcatcaagctgccgaacatcagcgcctcggtgccgcagctgcaagccgcgatccgc
gaactgcaatcgcgcggctatgcgatccccgacctgccggaagatccgaagaccgacgaa
gagaaagaaatcctgaagagctactccaaggtgctgggcagcgccgtcaacccggtcctg
cgcgaaggcaattccgaccgccgcgcaccggcatcgatcaagcgtttcgcccgcaagcat
ccgcacagcatgggcgagtggagcatggcctcgcgcagccacgtggcgcacatgaagcat
ggcgacttctaccacggtgaaaaatccatgaccatcggcgccgcgcgcgacgtcaagatg
gagctggtcggcaagagcggcaagaccacggtcctcaagcccaaggttgccctgaaggcc
ggcgaaatcatcgacagcatgttcatgagcaagaaggcgctgtgcgagttttacgaagag
caatttgaagatgcgcgcaagaccggcgtgatgctgtcgctgcacgtcaaggcgaccatg
atgaaggtgtcgcacccgatcgtgttcggccacgccgtcaagatcttctacaaggaagcc
ttcgccaagcacggcaagttgttcgacgaactgggcgtgaacgtcaacaacggcctggtc
aacctgtacgaaaagatcgagtccctgccgtcgtcgaagaaagaagaaatcatccgcgac
ctgcacgcctgtcacgaacaccgtccgtcgctggcgatggtcgactcggccaagggcatt
tccaacctgcacgcaccgaacgacgtgatcgtcgatgcatcgatgccggccatgatccgt
atcggcggcaagatgtgggacgccaacggcaagccgcaagacaccaaggcagtgatcccg
gaaagcaccttcgcccgtatctaccaggaagtcatcaacttctgcaaaaccaacggcaac
ttcgatccgaccaccatgggcaccgtgcctaacgtcggcctgatggcgcaaaaggcggaa
gaatacggttcgcacgacaagacattcgaaatcgccgaagacggcgtggccaatatcgtc
gacctcgccaccggcgaagtcctgctgacgcaaaatgtcgagcaaggcgacatctggcgc
atgtgccaggtcaaggacgaaccgatccgcgactgggtcaagctggccgtcacgcgcgca
cgcaactccggcatgccggccgtgttctggctggacccataccgtccgcacgaagccgaa
ctgatcaagaaggtcgagacttacctgaaggatcacgacaccaagggcctggacatccag
atcatgtcgcaagtgcgcgccatgcgttacacgctggaacgcgtcatccgcggcctcgac
accatctcggtgaccggcaacatcctgcgcgactacctgaccgacctgttcccgatcatg
gaactgggcaccagcgccaagatgctgtccatcgttccgctgatggcgggcggcggcatg
tacgaaaccggcgcgggcggttcggcgccgaagcacgtcaagcaactggtggaagagaac
catctgcgctgggattcgctgggcgagttcctggcattggcggtatcgctggaagacatg
ggcatcaagaccggcaacaagaaggcgcaagtgctgggcaaggcgctcgacgatgcaacc
ggcaagctgctggacaacaacaagtcgccatcgccgaagaccggcgagctggataaccgc
ggcagccatttctacctggccatgtactgggcgcaggaactggccgcgcaaaaggaagac
gccgaactggcggcgaagtttgcgccgctggccaagacattgaccgagaacgaagccaag
atcacggctgaactcaaggcagtgcaaggcaatccggtcgacatcggcggctacttcctg
gccgatccgaagaaggtcagcgcagtcatgcgtccgagcgccacgctcaacgcagcgctg
gcttcggtgaagtaa

DBGET integrated database retrieval system