Hyaena hyaena (striped hyena): 120233875 Help Entry 120233875         CDS       T07257                                  Symbol FGF4 Name (RefSeq) fibroblast growth factor 4   KO K04358   fibroblast growth factor Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv04010   MAPK signaling pathway hhv04014   Ras signaling pathway hhv04015   Rap1 signaling pathway hhv04020   Calcium signaling pathway hhv04151   PI3K-Akt signaling pathway hhv04810   Regulation of actin cytoskeleton hhv05200   Pathways in cancer hhv05207   Chemical carcinogenesis - receptor activation hhv05218   Melanoma hhv05224   Breast cancer hhv05226   Gastric cancer Brite KEGG Orthology (KO) [BR:hhv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120233875 (FGF4)    04014 Ras signaling pathway     120233875 (FGF4)    04015 Rap1 signaling pathway     120233875 (FGF4)    04020 Calcium signaling pathway     120233875 (FGF4)    04151 PI3K-Akt signaling pathway     120233875 (FGF4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     120233875 (FGF4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120233875 (FGF4)    05207 Chemical carcinogenesis - receptor activation     120233875 (FGF4)   09162 Cancer: specific types    05226 Gastric cancer     120233875 (FGF4)    05218 Melanoma     120233875 (FGF4)    05224 Breast cancer     120233875 (FGF4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hhv04052]     120233875 (FGF4)    00536 Glycosaminoglycan binding proteins [BR:hhv00536]     120233875 (FGF4) Cytokines and neuropeptides [BR:hhv04052]  Cytokines   Growth factors (RTK binding)    120233875 (FGF4) Glycosaminoglycan binding proteins [BR:hhv00536]  Heparan sulfate / Heparin   Growth factors/receptors    120233875 (FGF4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  120233875 NCBI-ProteinID:  XP_039091302 LinkDB All DBs Position Unknown AA seq 202 aa AA seqDB search MAGPRAAAAALLPAVLWAVLASWAAAAPAAPNGTLGAELERRWESLVARSLARLPVASQP KEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTSDSLLELSPVERG VVSIFGVASRFFVAMSGKGKLYGSPFFTEECKFKEILLPNNYNAYESYRYAGTFIALSKN GKTKKGGRVSPAMKVTHFLPRL NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atggcggggccccgggcggccgcggcggcgctgctcccggcggtcctgtgggccgtgctg gcgtcctgggccgccgccgcccccgccgcccccaacggcacgctgggggccgagctggag cgccgctgggagagcctggtggcgcgctcgctggcgcgcctgccggtggcctcgcagccc aaggaggcggccgtccagagcggcgccggcgactacctgctgggcatcaagcggctgcgg cggctctactgcaacgtgggcatcggcttccacctccaggtgctccccgacggccgcatc ggcggcgtgcacgcggacacgagcgacagccttctggagctctcgccggtggagcggggc gtggtgagcatcttcggagtggccagccggttcttcgtggccatgagcggcaagggcaaa ctgtacggctcgcccttcttcaccgaagagtgcaagttcaaagagatcctcctccctaac aactacaacgcctatgagagctaccgctacgcgggcacgttcatcgccctgagcaagaac ggcaagaccaagaaggggggccgggtgtcgcccgccatgaaggtcacccacttcctgccc cggctgtga

DBGET integrated database retrieval system