Hyaena hyaena (striped hyena): 120240185 Help Entry 120240185         CDS       T07257                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv01523   Antifolate resistance hhv04010   MAPK signaling pathway hhv04014   Ras signaling pathway hhv04024   cAMP signaling pathway hhv04062   Chemokine signaling pathway hhv04064   NF-kappa B signaling pathway hhv04066   HIF-1 signaling pathway hhv04071   Sphingolipid signaling pathway hhv04137   Mitophagy - animal hhv04151   PI3K-Akt signaling pathway hhv04210   Apoptosis hhv04211   Longevity regulating pathway hhv04218   Cellular senescence hhv04380   Osteoclast differentiation hhv04613   Neutrophil extracellular trap formation hhv04620   Toll-like receptor signaling pathway hhv04621   NOD-like receptor signaling pathway hhv04622   RIG-I-like receptor signaling pathway hhv04623   Cytosolic DNA-sensing pathway hhv04625   C-type lectin receptor signaling pathway hhv04657   IL-17 signaling pathway hhv04658   Th1 and Th2 cell differentiation hhv04659   Th17 cell differentiation hhv04660   T cell receptor signaling pathway hhv04662   B cell receptor signaling pathway hhv04668   TNF signaling pathway hhv04722   Neurotrophin signaling pathway hhv04917   Prolactin signaling pathway hhv04920   Adipocytokine signaling pathway hhv04926   Relaxin signaling pathway hhv04931   Insulin resistance hhv04932   Non-alcoholic fatty liver disease hhv04933   AGE-RAGE signaling pathway in diabetic complications hhv04936   Alcoholic liver disease hhv05010   Alzheimer disease hhv05022   Pathways of neurodegeneration - multiple diseases hhv05030   Cocaine addiction hhv05132   Salmonella infection hhv05133   Pertussis hhv05134   Legionellosis hhv05135   Yersinia infection hhv05140   Leishmaniasis hhv05142   Chagas disease hhv05145   Toxoplasmosis hhv05146   Amoebiasis hhv05152   Tuberculosis hhv05160   Hepatitis C hhv05161   Hepatitis B hhv05162   Measles hhv05163   Human cytomegalovirus infection hhv05164   Influenza A hhv05165   Human papillomavirus infection hhv05166   Human T-cell leukemia virus 1 infection hhv05167   Kaposi sarcoma-associated herpesvirus infection hhv05168   Herpes simplex virus 1 infection hhv05169   Epstein-Barr virus infection hhv05170   Human immunodeficiency virus 1 infection hhv05171   Coronavirus disease - COVID-19 hhv05200   Pathways in cancer hhv05202   Transcriptional misregulation in cancer hhv05203   Viral carcinogenesis hhv05207   Chemical carcinogenesis - receptor activation hhv05208   Chemical carcinogenesis - reactive oxygen species hhv05212   Pancreatic cancer hhv05215   Prostate cancer hhv05220   Chronic myeloid leukemia hhv05221   Acute myeloid leukemia hhv05222   Small cell lung cancer hhv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer hhv05321   Inflammatory bowel disease hhv05415   Diabetic cardiomyopathy hhv05417   Lipid and atherosclerosis hhv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:hhv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120240185 (RELA)    04014 Ras signaling pathway     120240185 (RELA)    04064 NF-kappa B signaling pathway     120240185 (RELA)    04668 TNF signaling pathway     120240185 (RELA)    04066 HIF-1 signaling pathway     120240185 (RELA)    04071 Sphingolipid signaling pathway     120240185 (RELA)    04024 cAMP signaling pathway     120240185 (RELA)    04151 PI3K-Akt signaling pathway     120240185 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     120240185 (RELA)   09143 Cell growth and death    04210 Apoptosis     120240185 (RELA)    04218 Cellular senescence     120240185 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     120240185 (RELA)    04620 Toll-like receptor signaling pathway     120240185 (RELA)    04621 NOD-like receptor signaling pathway     120240185 (RELA)    04622 RIG-I-like receptor signaling pathway     120240185 (RELA)    04623 Cytosolic DNA-sensing pathway     120240185 (RELA)    04625 C-type lectin receptor signaling pathway     120240185 (RELA)    04660 T cell receptor signaling pathway     120240185 (RELA)    04658 Th1 and Th2 cell differentiation     120240185 (RELA)    04659 Th17 cell differentiation     120240185 (RELA)    04657 IL-17 signaling pathway     120240185 (RELA)    04662 B cell receptor signaling pathway     120240185 (RELA)    04062 Chemokine signaling pathway     120240185 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     120240185 (RELA)    04917 Prolactin signaling pathway     120240185 (RELA)    04926 Relaxin signaling pathway     120240185 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     120240185 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     120240185 (RELA)   09149 Aging    04211 Longevity regulating pathway     120240185 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120240185 (RELA)    05202 Transcriptional misregulation in cancer     120240185 (RELA)    05207 Chemical carcinogenesis - receptor activation     120240185 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     120240185 (RELA)    05203 Viral carcinogenesis     120240185 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     120240185 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     120240185 (RELA)    05221 Acute myeloid leukemia     120240185 (RELA)    05220 Chronic myeloid leukemia     120240185 (RELA)    05215 Prostate cancer     120240185 (RELA)    05222 Small cell lung cancer     120240185 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     120240185 (RELA)    05170 Human immunodeficiency virus 1 infection     120240185 (RELA)    05161 Hepatitis B     120240185 (RELA)    05160 Hepatitis C     120240185 (RELA)    05171 Coronavirus disease - COVID-19     120240185 (RELA)    05164 Influenza A     120240185 (RELA)    05162 Measles     120240185 (RELA)    05168 Herpes simplex virus 1 infection     120240185 (RELA)    05163 Human cytomegalovirus infection     120240185 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     120240185 (RELA)    05169 Epstein-Barr virus infection     120240185 (RELA)    05165 Human papillomavirus infection     120240185 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     120240185 (RELA)    05135 Yersinia infection     120240185 (RELA)    05133 Pertussis     120240185 (RELA)    05134 Legionellosis     120240185 (RELA)    05152 Tuberculosis     120240185 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     120240185 (RELA)    05145 Toxoplasmosis     120240185 (RELA)    05140 Leishmaniasis     120240185 (RELA)    05142 Chagas disease     120240185 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     120240185 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     120240185 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     120240185 (RELA)   09165 Substance dependence    05030 Cocaine addiction     120240185 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120240185 (RELA)    05418 Fluid shear stress and atherosclerosis     120240185 (RELA)    05415 Diabetic cardiomyopathy     120240185 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     120240185 (RELA)    04932 Non-alcoholic fatty liver disease     120240185 (RELA)    04931 Insulin resistance     120240185 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     120240185 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     120240185 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:hhv03000]     120240185 (RELA) Transcription factors [BR:hhv03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     120240185 (RELA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  120240185 NCBI-ProteinID:  XP_039100808 LinkDB All DBs Position Unknown AA seq 545 aa AA seqDB search MDDLFPLIFPTEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLPPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSSTAVPKPAPQSYPFTSSLSTINF EEFSPMVFPSGQIPSQPSALAPAPAPILAPAPAPVPAPAPAPAPILAPGLAQAVVPPAPK TTQAGEGTLTEALLHLQFDADEDLGALLGNSADPAVFTDLASVDNSEFQQLLNQGVSVAP HAAEPMLMEYPEAITRLVTGSQRPPDPAPAPLGASGLPNGLLSGDEDFSSIADMDFSALL SQISS NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt atggacgacctgtttcccctcatcttcccgactgagccagcccaggcctctggcccctat gtggaaatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggt cgctccgcgggcagtatccccggcgagaggagcacagataccaccaagacccaccccacc atcaagatcaatggctacaccgggccagggacagttcgcatctcattggtcaccaaggac ccccctcatcggcctcacccccacgagctggtgggaaaagactgccgggatggcttctat gaggctgagctctgcccagaccgctgcatccacagcttccagaacctggggatccagtgt gtgaagaagcgggacctggagcaggccattagtcaacgcatccagaccaacaacaatccc ttccaagttcccatagaagaacagcgtggggactacgacctgaatgcggtgcggctctgt ttccaggtgacagtgcgggacccggcaggcaggcccctccgcttgccacctgtcctctct catcccatctttgacaaccgtgcccccaacaccgccgagctcaagatctgccgagtgaac cgaaactctgggagctgcctcggtggggatgagatcttcctgctgtgtgacaaggtgcag aaagaggacatcgaagtgtatttcacgggaccaggctgggaggcccgaggctccttctct caagccgatgtacaccgacaagtggccattgtgttccggacacctccctatgcggacccc agcctgcaggcgcccgtgcgagtctccatgcagctgcggcggccttcagatcgggagctc agcgaacccatggagttccagtacttgccagacacagatgatcgtcaccggattgaggag aaacgcaaaaggacatacgagaccttcaagagcatcatgaaaaagagtcctttcaatgga cccaccgacccccggcctccaccccggcgcattgctgtgccttcccgaagctcaactgct gtccccaagccagctccccagtcctatccctttacgtcatccctcagcaccatcaacttc gaagagttctcccccatggtctttccttctgggcagatcccaagccagccctctgccttg gcaccagcccctgccccaatcctggcccctgccccggcccctgtcccggcccctgccccg gcccctgccccaatcttagccccaggccttgcccaggctgtggtcccgcctgctcccaag accacccaggctggggaagggacactgacggaggccctgctgcacctgcagtttgacgct gatgaagacctgggggccctgctcggcaatagcgccgacccagccgtgttcacagacctg gcatccgtcgacaactctgagtttcagcaactgctgaaccagggtgtgtctgtggccccc cacgcagctgagcccatgctgatggagtaccctgaggcaataactcgcctggtgacagga tcccagaggccccctgacccagctcccgctcccctgggggcctctgggcttcccaacggc ctcctgtcaggggatgaagacttctcttccattgcagacatggacttctcagcccttctg agtcagatcagctcctaa

DBGET integrated database retrieval system