KEGG   Haemophilus influenzae R2846 (nontypeable): R2846_0005Help
Entry
R2846_0005        CDS       T01980                                 

Gene name
tufA
Definition
(GenBank) Elongation factor Tu (EF-Tu)
  KO
K02358  
elongation factor Tu
Organism
hie  Haemophilus influenzae R2846 (nontypeable)
Brite
Translation factors [BR:hie03012]
 Eukaryotic Type
  Elongation factors
   R2846_0005 (tufA)
 Prokaryotic Type
   R2846_0005 (tufA)
Mitochondrial biogenesis [BR:hie03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    R2846_0005 (tufA)
Exosome [BR:hie04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   R2846_0005 (tufA)
  Exosomal proteins of breast cancer cells
   R2846_0005 (tufA)
  Exosomal proteins of colorectal cancer cells
   R2846_0005 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
5325..6509
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKHYGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALQALN
GVAEWEEKILELANHLDTYIPEPERAIDQPFLLPIEDVFSISGRGTVVTGRVERGIIRTG
DEVEIVGIKDTAKTTVTGVEMFRKLLDEGRAGENIGALLRGTKREEIERGQVLAKPGSIT
PHTDFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMT
VSLIHPIAMDQGLRFAIREGGRTVGAGVVAKIIK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaaatttgaacgtacaaaaccgcacgtaaacgtgggtacaatcggccac
gttgaccacggtaaaacaactttaacagcagcaatcacaaccgtattagcaaaacattac
ggtggtgcagcgcgtgcatttgaccaaattgataacgcaccagaagaaaaagcgcgtggt
attaccatcaacacttcacacgttgaatacgatacgccgactcgccactacgcacacgta
gactgtccgggacacgccgactatgttaaaaatatgattactggtgcggcacaaatggat
ggtgctattttagtagtagcagcaacagatggtcctatgccacaaactcgtgaacacatc
ttattaggtcgccaagtaggtgtaccatacatcatcgtattcttaaacaaatgcgatatg
gtagatgacgaagagttattagaattagtagaaatggaagttcgtgaacttctatctcaa
tatgacttcccaggtgacgatacaccaatcgtacgtggttctgcattacaagcgttaaac
ggcgtagcagaatgggaagaaaaaatccttgagttagcaaaccacttagatacttatatt
ccagaaccagaacgtgcgattgaccaaccgtttcttcttccaatcgaagatgtgttctca
atctcaggtcgtggtacagtagtaactggtcgtgtagaacgtggtatcatccgtacaggt
gatgaagtagaaatcgtcggtatcaaagatacagcgaaaactactgtaacgggtgttgaa
atgttccgtaaattacttgacgaaggtcgtgcaggtgaaaacatcggtgcattattacgt
ggtaccaaacgtgaagaaatcgaacgtggtcaagtattagcgaaaccaggttcaatcaca
ccacacactgacttcgaatcagaagtgtacgtattatcaaaagatgaaggtggtcgtcat
actccattcttcaaaggttaccgtccacaattctatttccgtacaacagacgtgactggt
actatcgaattaccagaaggcgtggaaatggtaatgccaggcgataacatcaagatgaca
gtaagcttaatccacccaatcgcaatggatcaaggtttacgtttcgcaatccgtgaaggt
ggccgtacagtaggtgctggcgttgttgcgaaaatcatcaaataa

DBGET integrated database retrieval system