KEGG   Haemophilus influenzae 477: NTHI477_01689Help
Entry
NTHI477_01689     CDS       T03720                                 

Gene name
tufA_1
Definition
(GenBank) Elongation factor Tu protein
  KO
K02358  
elongation factor Tu
Organism
hiw  Haemophilus influenzae 477
Brite
Translation factors [BR:hiw03012]
 Eukaryotic Type
  Elongation factors
   NTHI477_01689 (tufA_1)
 Prokaryotic Type
   NTHI477_01689 (tufA_1)
Mitochondrial biogenesis [BR:hiw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    NTHI477_01689 (tufA_1)
Exosome [BR:hiw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NTHI477_01689 (tufA_1)
  Exosomal proteins of breast cancer cells
   NTHI477_01689 (tufA_1)
  Exosomal proteins of colorectal cancer cells
   NTHI477_01689 (tufA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1707674..1708858)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKHYGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALQALN
GVAEWEEKILELAGHLDTYIPEPERAIDQPFLLPIEDVFSISGRGTVVTGRVERGIIRTG
DEVEIVGIKDTAKTTVTGVEMFRKLLDEGRAGENIGALLRGTKREEIERGQVLAKPGSIT
PHTDFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMT
VSLIHPIAMDQGLRFAIREGGRTVGAGVVAKIIK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaaatttgaacgtacaaaaccgcacgtaaacgtgggtacaatcggccac
gttgaccacggtaaaacaactttaacagcagcaatcacaaccgtattagcaaaacactac
ggtggtgcagcgcgtgcatttgaccaaattgataacgcgccagaagaaaaagcgcgtggt
attaccatcaacacttcacacgttgaatatgatacaccgactcgccactacgcacacgta
gactgtccgggacacgccgactatgttaaaaatatgattactggtgcggcgcaaatggat
ggtgctattttagtagtagcagcaacagatggtcctatgccacaaactcgtgaacacatc
ttattaggtcgccaagtaggtgttccatacatcatcgtattcttaaacaaatgcgacatg
gtagatgacgaagagttattagaattagtagaaatggaagtgcgtgaacttctatctcaa
tatgacttcccgggtgacgatactccaatcgtacgtggttcagcattacaagcattaaac
ggcgtagcagaatgggaagaaaaaatcctagaattagcaggtcacttagatacttatatt
ccagaaccagaacgtgcgattgaccaaccgttccttcttccaatcgaagacgtattctca
atctcaggtcgtggtacagtagtaacaggtcgtgtagaacgtggtatcatccgtactggt
gatgaagtagaaatcgtcggtatcaaagatacagcgaaaactactgtaacaggtgttgaa
atgttccgtaaattacttgacgaaggtcgtgcaggtgaaaatatcggtgcattattacgt
ggtaccaaacgtgaagaaatcgaacgtggtcaagtattagcgaaaccaggttcaatcaca
ccacacactgattttgaatcagaagtatacgtattatcaaaagatgaaggtggtcgtcat
actccattcttcaaaggttaccgtccacaattctatttccgtacaacagacgtgactggt
actatcgaattaccagaaggcgtggaaatggtaatgccaggggataacatcaagatgaca
gtaagcttaatccacccaatcgcgatggatcaaggtttacgtttcgcaatccgtgaaggt
ggccgtacagtaggtgcaggcgttgttgcgaaaatcatcaaataa

DBGET integrated database retrieval system