KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_1851Help
Entry
R2866_1851        CDS       T01981                                 

Gene name
tufB
Definition
(GenBank) Elongation factor Tu (EF-Tu)
  KO
K02358  
elongation factor Tu
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
Brite
Translation factors [BR:hiz03012]
 Eukaryotic Type
  Elongation factors
   R2866_1851 (tufB)
 Prokaryotic Type
   R2866_1851 (tufB)
Mitochondrial biogenesis [BR:hiz03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    R2866_1851 (tufB)
Exosome [BR:hiz04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   R2866_1851 (tufB)
  Exosomal proteins of breast cancer cells
   R2866_1851 (tufB)
  Exosomal proteins of colorectal cancer cells
   R2866_1851 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1889307..1890491)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKHYGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALQALN
GVAEWEEKILELAGHLDTYIPEPERAIDQPFLLPIEDVFSISGRGTVVTGRVERGIIRTG
DEVEIVGIKDTAKTTVTGVEMFRKLLDEGRAGENIGALLRGTKREEIERGQVLAKPGSIT
PHTDFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMT
VSLIHPIAMDQGLRFAIREGGRTVGAGVVAKIIK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaaatttgaacgtacaaaaccgcacgtaaacgtgggtacaatcggccac
gttgaccacggtaaaacaactttaacagcagcaatcacaaccgtattagcaaaacattac
ggtggtgcagcgcgcgcattcgaccaaatcgataacgcgccagaagaaaaagcgcgtggt
attaccatcaacacttcacatgttgaatacgatacaccaactcgccactatgcacacgta
gactgtccaggacacgccgactatgttaaaaacatgattaccggtgcggcgcaaatggac
ggtgctattttagtagtagcagcaacagatggtcctatgccacaaactcgtgaacacatc
ttattaggtcgccaagtaggtgtaccatacatcatcgtattcttaaacaaatgcgatatg
gtagatgatgaagagttattagaattagtagaaatggaagtgcgtgaacttctatctcaa
tatgacttcccaggtgacgacacgccaatcgtacgtggttcagcattacaagcattgaac
ggcgtagcagaatgggaagaaaaaatcctagaattagcaggtcacttagatacttatatt
ccagaaccagaacgtgcgattgaccaaccgttccttcttccaatcgaagatgtgttctca
atctcaggtcgtggtactgtagtaacaggtcgtgtagaacgtggtatcatccgtacaggt
gatgaagtagaaatcgtcggtatcaaagatacagcgaaaactactgtaacgggtgttgaa
atgttccgtaaattacttgacgaaggtcgtgcaggtgaaaacatcggtgcattattacgt
ggtaccaaacgtgaagaaatcgaacgtggtcaagtattagcgaaaccaggttcaatcaca
ccacacactgacttcgaatcagaagtgtacgtattatcaaaagatgaaggtggtcgtcat
actccattcttcaaaggttaccgtccacaattctatttccgtacaacagacgtgactggt
actatcgaattaccagaaggcgtggaaatggtaatgccaggcgataacatcaagatgaca
gtaagcttaatccacccaatcgcgatggatcaaggtttacgtttcgcaatccgtgaaggt
ggccgtacagtaggtgcaggcgttgttgcgaaaatcatcaaataa

DBGET integrated database retrieval system