KEGG   Halalkalicoccus jeotgali: HacjB3_07675Help
Entry
HacjB3_07675      CDS       T01271                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
hje  Halalkalicoccus jeotgali
Brite
Enzymes [BR:hje01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     HacjB3_07675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1427821..1428456
Genome map
AA seq 211 aa AA seqDB search
MVELEEITMPEKSNAELPPLPYDYDALEPSISEQVVTWHHDTHHQGYVNGLNSAEETLAE
NRESGDYSSTGGALGNVTHNGSGHYLHTLFWENMSPEGGDEPSGDLRERIEEDFGSYEGW
KGEFEAAAKAAGGWALLVYDPVAKQLRNLAVDKHDQGALWGAHPVLALDVWEHSYYYDYG
PDRGDFIDAFFDVVNWDEAEDQYQKSVDHFE
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggtagaactggaggagattaccatgccagagaaatcaaacgccgaactgccgccgctt
ccgtacgactacgacgcgctcgaaccgtcgatctccgagcaggtcgtcacgtggcaccac
gacacgcaccaccagggatacgtaaacggcctcaacagcgccgaggagacgctcgcggag
aaccgcgagtccggtgattactcctcgacgggcggcgcgctcggcaacgtcacccacaac
ggctcgggccactatctccacacgctgttctgggagaacatgagccccgagggcggcgac
gagccgtcgggcgacctcagagagcgcatcgaggaggacttcggctcctacgagggctgg
aagggcgagttcgaggctgccgcaaaggccgccggtggctgggcgctgttggtctacgac
ccggttgccaagcagcttcgcaacctcgcagtcgataagcacgaccagggtgccctctgg
ggggcccaccccgtgctggcgctcgacgtctgggaacactcgtactactacgactacggc
ccggaccgcggcgacttcatcgacgccttcttcgacgtcgtcaactgggacgaggccgaa
gaccagtaccagaagtccgtcgaccacttcgagtaa

DBGET integrated database retrieval system