KEGG   Hyphomicrobium sp. MC1: HYPMC_4392Help
Entry
HYPMC_4392        CDS       T01557                                 

Definition
(GenBank) putative phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hmc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HYPMC_4392
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    HYPMC_4392
   00680 Methane metabolism
    HYPMC_4392
Enzymes [BR:hmc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     HYPMC_4392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4222504..4225356)
Genome map
AA seq 950 aa AA seqDB search
MMQDTTPAVGSNKLDEIELINQLKRLRAQIPDNPSLNPILNVAFDMSRRLEAGEVSFDEM
KGLAGRLMDRAFVRRARGLREKVGYVDQATTLKDFTAYVEKTATESGNNLKAFEERWSRA
RTGIVLTAHPTFGLSDALYRRMVDIAVSDPTSDVTIGLPHRPEDKLTLHHEHKCAQDAIR
NLRNAYEELLHGFYSVASQKFGDAAFKVRPRLTTFASWVGYDLDGRTDITWTFSFETRLR
EKRAALADIRERFVVLKHKLESGDAAQRVARQIVGKLDLGIAAVDEQLKALESFANNTEG
LAKAANVMTKTDGYNLLTVEALQALFNNLIDAVQAPQMKRATAALAGLVEATGLGMSHIH
LRINALQLHNAFRAYVHEPWTRDLTESQSLKRIVEMIKNTPRETVNFATLDLETATAIRQ
FALTAQIMKHVDKETPIRFLIAECESPATVLIAVFFAKLFGVDHITDISPLFETPTGLEN
GARIMERLIEEEAYREYVIGRKRISIQTGFSDAGRFIGQISATLAVERYYKALAGIVDAA
KLEGIETLLFSTHGESMGRGAHPGTLYRRLHYVMTNEARRRFGAANIPVKHETSFQGGDG
YVFFGNRALTTRALATIVMDGDIPPAEKDPFYSAQDFSFDFFLRLRGFQQDLFAHDGYRA
VLGAFGPNLLFKTGSRPVKRQGDHASDRGNPARMRAIPNNAILQQFGYIANVVAGLGAAV
GVDRDRFYKLAKKSKRLQSLLAMIAHGKTMSSLNAMAANAQVFNAGLWASRASWGREEAL
NSAFRTLATHLLPDDRYGDVSELVHLLRLDAIDLHAILADLNIEDGMVPDENRLELDLLQ
AIRLALIMRIFILAAQLPRFAPQDGLSHAQVLEMALSLEIPEVLSILRKAFPHDEKNLTA
KSFDEQASYRPRGIDDYARLETEILTPMEISYEFIREIGTGISHHFGAFG
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcaggatacgacgcccgctgttggctcgaacaagctcgacgaaatcgagctgatc
aatcagctgaagcgtcttagagcgcaaattcccgataacccttcgctcaacccgattttg
aacgtcgcgttcgacatgtctcggcgtcttgaggcgggcgaagtgtcgttcgacgagatg
aagggccttgccggccggctgatggatcgggccttcgttcgccgcgcccgtggcctgcgc
gagaaggtcggctatgtcgatcaggcgaccacgctgaaggacttcacggcctacgtcgaa
aagacggcaaccgagtccggcaacaatctcaaagcgtttgaagagcgttggtcgcgtgcc
cgcaccggcatcgttctgaccgcgcatccgacgttcggcctttccgacgcgctctaccgg
cgcatggtcgatatcgcggtttccgatccaacgtccgacgtcacgatcggcttaccgcat
cgcccggaagataagctgacgctccatcacgagcacaagtgcgcccaggatgcgatccgc
aacctgcgcaatgcctacgaagaactgttgcacggcttctatagcgtcgcgtcgcagaag
ttcggtgacgcggcgttcaaagtgcgcccgaggctgacgacgtttgcgtcgtgggtcggc
tacgatcttgacggccgcaccgacatcacctggacgttctcgtttgaaacccgccttcgc
gagaagcgcgccgccttggccgatatccgcgaacgcttcgtcgtcctgaagcacaagctc
gaaagcggtgacgccgcacaacgcgtcgctcgtcagatcgtcggcaagctcgatctcggc
atcgctgccgtcgatgagcaattgaaggcgctcgaaagcttcgccaacaacaccgaaggc
ctcgccaaggccgccaacgtcatgacaaagacggacggctacaacctgctgacggtcgag
gcgctacaggctctcttcaacaatctgatcgatgcggtccaggcgccgcagatgaagcgc
gccaccgccgcgctcgccggcctcgtcgaggcaaccggcctcggcatgtcgcatatccac
ctgcgcatcaacgccctgcagctccacaacgcattccgcgcttacgtgcacgagccgtgg
acgcgcgatctgaccgaaagtcagtcgctgaagcgcattgtcgagatgatcaagaacacg
ccgcgcgagacggtcaacttcgcgacgctcgatctcgaaaccgcgactgcgatccgccag
tttgcgcttaccgcgcagatcatgaagcacgtcgataaggaaacgccgatccgcttcctc
atcgccgaatgcgagtcgcctgcaacggttttgattgcagtgttcttcgccaagctcttc
ggcgtcgatcacatcaccgatatctctccgcttttcgaaactccgacgggtcttgagaat
ggcgcacgcatcatggagcgcctcatcgaagaagaggcctaccgcgagtacgtgatcggc
cgaaagcggatcagcattcaaactggcttctccgacgctggccggttcatcggacaaatc
tcggcgacgctggccgtcgaacgctactacaaggcgctggccgggatcgtcgacgccgcc
aagctcgaaggcatcgagacgctgctcttttcgacccacggcgagtcgatgggccgcggt
gcgcatcccggcacgctttaccgtcgtctgcactacgtgatgacgaatgaagcacgccgc
cgcttcggcgccgccaacattcccgtgaagcacgagacgagcttccagggcggcgacggc
tatgtcttcttcggcaaccgcgctttaacgacccgcgcgctcgcaaccatcgtgatggat
ggcgacatcccgcccgctgaaaaggatccgttttattcggcgcaggatttcagctttgac
ttcttcctgcgtcttcgcggcttccagcaggacctgttcgcgcacgatggatatcgcgct
gtcctcggcgccttcggaccgaacctgttgttcaagacagggtctcgtccggtaaagcgc
cagggcgatcacgcatccgaccgcggcaacccggcccgcatgcgcgccatcccgaacaat
gccattctccagcagttcggctatatcgccaacgtcgtcgccggtcttggcgccgctgtc
ggcgtcgatcgcgaccgattctataaacttgcgaaaaagtcgaagcgattgcagtcgctg
cttgcaatgattgcgcacggcaagacgatgtcgagcctcaatgccatggccgcgaacgct
caagtcttcaatgccgggctttgggcgtcgcgcgcctcatggggccgtgaggaagcgctg
aacagcgccttccgtacgctcgcgacgcatctgctgccggatgatcgttatggcgacgtc
tccgaactcgtccatctgctgcgtctcgacgccatcgaccttcacgccatcctcgccgat
ttgaacatcgaagatggcatggtccctgacgagaaccggctcgaactcgatctcctgcag
gcgatccgcctcgcgctgatcatgcgcattttcattctggctgcgcagcttccgcgcttc
gccccgcaggacggactttcgcatgcgcaggtgctcgagatggccctgagcttggaaatt
ccggaagttctgagcatcctgcgcaaagcgttcccgcacgacgaaaagaacctgaccgcg
aagtccttcgacgagcaggcgagctatcgtccgcgcggcatcgacgactacgcgcgcttg
gaaacggaaatcctgacgccgatggaaatctcgtacgagttcattcgcgagatcggcacc
ggcatctcgcaccacttcggcgccttcggctga

DBGET integrated database retrieval system