KEGG   Hydra vulgaris: 100204901Help
Entry
100204901         CDS       T01080                                 

Definition
(RefSeq) phosphoenolpyruvate phosphomutase-like
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
hmg  Hydra vulgaris
Pathway
hmg00440  Phosphonate and phosphinate metabolism
hmg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    100204901
Enzymes [BR:hmg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     100204901
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEP_mutase ICL
Motif
Other DBs
NCBI-GeneID: 100204901
NCBI-ProteinID: XP_002158406
LinkDB All DBs
Position
Un
AA seq 319 aa AA seqDB search
MSFILKKCILNNQMASISLKYFSTSSTLSKRTTLLKQMLHSNELEFIMEAHTGLAAKIVE
EAGFKGIWGSGLSISASMGVRDSNEASWTQVLDQLEYMTDASSLPILLDADTGYGNFNNA
RRLVRKLEQRGVAGACLEDKLFPKTNSLLDGRAQPLADMEEFALKIKACKDSQRDPDFCI
VARVEAFIAGWGLEEALKRSHAYADAGADAILMHSKKKDPSEIKAFMKEWKNKIPVVIVP
TNYYTTPTNEFREWGVSMVIWANHNIRASIKAMQDTCNTIYNDQSLVNVESKVVPVKEIF
RLQNDKELVEAEKIYLPQK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagttttattctaaaaaaatgcattttaaataaccaaatggcatcaatatctttaaaa
tatttttcaacatcctcaactctttcaaagcggacaacgcttcttaagcaaatgctgcat
tcaaacgaacttgaatttataatggaagcacacacagggttagctgcaaaaattgtagaa
gaagctggctttaaaggcatttggggtagtggattatctatttctgcgtcaatgggagtg
cgtgatagtaatgaagcatcatggacacaagtgttagaccagttagaatatatgacagat
gcatcatcacttcctatattactagatgctgatactggttatggtaattttaacaatgct
agaaggttagtgcgaaaattagaacagcgaggtgtagctggagcatgtcttgaagacaaa
ttgtttccaaaaacaaactctttattagatggacgagctcagccattagcagatatggag
gagtttgctttaaaaattaaagcatgcaaagatagccaacgagatcctgatttctgcatt
gttgctcgtgttgaggcttttatagctggctggggattagaagaagcattaaagagatca
catgcttatgcagatgctggtgcagatgctatattgatgcacagtaagaaaaaagaccct
tcagaaattaaagcttttatgaaggaatggaaaaataaaattcctgttgtgattgttcca
acaaattactatacaacaccaacaaacgagtttcgtgagtggggggtatccatggtcata
tgggctaaccataatattcgtgcatccataaaagctatgcaagacacgtgcaatactatt
tataatgaccaatcccttgttaatgttgaaagcaaggttgtaccagtcaaagaaattttt
cgacttcagaacgataaagaattagtggaagctgaaaaaatatatttgccacaaaaataa

DBGET integrated database retrieval system