Hylobates moloch (silvery gibbon): 116474621 Help Entry 116474621         CDS       T08803                                  Symbol CALML3 Name (RefSeq) calmodulin-like protein 3   KO K02183   calmodulin Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04014   Ras signaling pathway hmh04015   Rap1 signaling pathway hmh04020   Calcium signaling pathway hmh04022   cGMP-PKG signaling pathway hmh04024   cAMP signaling pathway hmh04070   Phosphatidylinositol signaling system hmh04114   Oocyte meiosis hmh04218   Cellular senescence hmh04261   Adrenergic signaling in cardiomyocytes hmh04270   Vascular smooth muscle contraction hmh04371   Apelin signaling pathway hmh04625   C-type lectin receptor signaling pathway hmh04713   Circadian entrainment hmh04720   Long-term potentiation hmh04722   Neurotrophin signaling pathway hmh04728   Dopaminergic synapse hmh04740   Olfactory transduction hmh04744   Phototransduction hmh04750   Inflammatory mediator regulation of TRP channels hmh04910   Insulin signaling pathway hmh04912   GnRH signaling pathway hmh04915   Estrogen signaling pathway hmh04916   Melanogenesis hmh04921   Oxytocin signaling pathway hmh04922   Glucagon signaling pathway hmh04924   Renin secretion hmh04925   Aldosterone synthesis and secretion hmh04970   Salivary secretion hmh04971   Gastric acid secretion hmh05010   Alzheimer disease hmh05012   Parkinson disease hmh05022   Pathways of neurodegeneration - multiple diseases hmh05031   Amphetamine addiction hmh05034   Alcoholism hmh05133   Pertussis hmh05152   Tuberculosis hmh05163   Human cytomegalovirus infection hmh05167   Kaposi sarcoma-associated herpesvirus infection hmh05170   Human immunodeficiency virus 1 infection hmh05200   Pathways in cancer hmh05214   Glioma hmh05417   Lipid and atherosclerosis hmh05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:hmh00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     116474621 (CALML3)    04015 Rap1 signaling pathway     116474621 (CALML3)    04371 Apelin signaling pathway     116474621 (CALML3)    04020 Calcium signaling pathway     116474621 (CALML3)    04070 Phosphatidylinositol signaling system     116474621 (CALML3)    04024 cAMP signaling pathway     116474621 (CALML3)    04022 cGMP-PKG signaling pathway     116474621 (CALML3)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     116474621 (CALML3)    04218 Cellular senescence     116474621 (CALML3)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     116474621 (CALML3)   09152 Endocrine system    04910 Insulin signaling pathway     116474621 (CALML3)    04922 Glucagon signaling pathway     116474621 (CALML3)    04912 GnRH signaling pathway     116474621 (CALML3)    04915 Estrogen signaling pathway     116474621 (CALML3)    04921 Oxytocin signaling pathway     116474621 (CALML3)    04916 Melanogenesis     116474621 (CALML3)    04924 Renin secretion     116474621 (CALML3)    04925 Aldosterone synthesis and secretion     116474621 (CALML3)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     116474621 (CALML3)    04270 Vascular smooth muscle contraction     116474621 (CALML3)   09154 Digestive system    04970 Salivary secretion     116474621 (CALML3)    04971 Gastric acid secretion     116474621 (CALML3)   09156 Nervous system    04728 Dopaminergic synapse     116474621 (CALML3)    04720 Long-term potentiation     116474621 (CALML3)    04722 Neurotrophin signaling pathway     116474621 (CALML3)   09157 Sensory system    04744 Phototransduction     116474621 (CALML3)    04740 Olfactory transduction     116474621 (CALML3)    04750 Inflammatory mediator regulation of TRP channels     116474621 (CALML3)   09159 Environmental adaptation    04713 Circadian entrainment     116474621 (CALML3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     116474621 (CALML3)   09162 Cancer: specific types    05214 Glioma     116474621 (CALML3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     116474621 (CALML3)    05163 Human cytomegalovirus infection     116474621 (CALML3)    05167 Kaposi sarcoma-associated herpesvirus infection     116474621 (CALML3)   09171 Infectious disease: bacterial    05133 Pertussis     116474621 (CALML3)    05152 Tuberculosis     116474621 (CALML3)   09164 Neurodegenerative disease    05010 Alzheimer disease     116474621 (CALML3)    05012 Parkinson disease     116474621 (CALML3)    05022 Pathways of neurodegeneration - multiple diseases     116474621 (CALML3)   09165 Substance dependence    05031 Amphetamine addiction     116474621 (CALML3)    05034 Alcoholism     116474621 (CALML3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116474621 (CALML3)    05418 Fluid shear stress and atherosclerosis     116474621 (CALML3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:hmh01009]     116474621 (CALML3)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hmh04131]     116474621 (CALML3)    03036 Chromosome and associated proteins [BR:hmh03036]     116474621 (CALML3)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hmh04147]     116474621 (CALML3) Protein phosphatases and associated proteins [BR:hmh01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      116474621 (CALML3) Membrane trafficking [BR:hmh04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     116474621 (CALML3) Chromosome and associated proteins [BR:hmh03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      116474621 (CALML3) Exosome [BR:hmh04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    116474621 (CALML3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 UPF0154 EF-hand_4 EFhand_Ca_insen Caleosin PHL Fe_hyd_lg_C Latarcin Motif Other DBs NCBI-GeneID:  116474621 NCBI-ProteinID:  XP_058285449 EnsemblRapid:  ENSHMOG00005002759 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MADQLTEEQITEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDG NGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDE EVDEMIRAADTDGDGQHLFSALLPTFPPAHLNDMQHSHSKQTVKPSPLGRSRADLRTTRQ GRLR NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atggccgaccagctgactgaggagcagatcacagaattcaaggaggccttctccctgttt gacaaggatggggacggctgcatcaccacccgcgagctgggcacggtcatgcggtccctg ggccagaaccccacggaggccgagctgcgggacatgatgagtgagatcgaccgggacggc aacggcaccgtggacttccccgagttcctgggcatgatggccaggaagatgaaggacacg gacaacgaggaggagatccgcgaggccttccgcgtgttcgacaaggacggcaacggcttt gtcagcgccgccgagctgcgacacgtcatgacccggctgggggagaagctgagtgacgag gaggtggacgagatgatccgggccgcggacacggacggagacggacagcatctcttctct gctctcctgccgaccttcccacctgctcatctgaatgacatgcaacactcccactccaag caaaccgtgaagccctccccactcgggagaagcagagctgaccttaggaccacgcgccag ggcaggttgcgctga

DBGET integrated database retrieval system