KEGG   Hyphomicrobium nitrativorans: W911_11355Help
Entry
W911_11355        CDS       T02943                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
hni  Hyphomicrobium nitrativorans
Pathway
hni00473  D-Alanine metabolism
hni01100  Metabolic pathways
hni01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hni00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    W911_11355
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    W911_11355
Enzymes [BR:hni01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     W911_11355
Peptidoglycan biosynthesis and degradation proteins [BR:hni01011]
 Precursor biosynthesis
  Racemase
   W911_11355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AHB48866
UniProt: V5SDC4
LinkDB All DBs
Position
2363731..2364861
Genome map
AA seq 376 aa AA seqDB search
MTAPPDLPPGATGVITVDLDAIADNWRALGALVTPAECGAVVKADAYGLGAIKVVPALAR
AGCRTFFIATPDEAEAARRFAPDARLFALDGLLPGAASVFSANDIAPVLTSLEELAVWSA
EATRTGKRLPAGLQIDSGLNRLGLSEDDVRTLASAPARLDGIDLRLVMSHLACADDPAHP
HNETQRSNFDRLRTLLPPTPASLAASDGLMLGARFHYDLVRPGYALYGGQAFQGGPTPVR
PAVTVEARVLQVRTLSPGDPVGYSATWRAARPTRLAVISAGYADGIARALSASTEREGGV
IAIHGEAAPIVGRVSMDLITADVTDIAAAIAPGDLATLVGPGLTVEAMGQAGGTIGYEVL
TRLGTRFARHYVGGGG
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaccacccgatctcccgcccggcgcgaccggcgtcatcaccgtcgacctcgac
gcgatcgccgacaactggcgcgcgctcggcgcgctcgtgacgcctgccgaatgcggcgcc
gtggtcaaagccgacgcgtatggccttggcgccatcaaggtggtccccgcgctcgcccgc
gccgggtgccgcacatttttcatcgccactcccgacgaagcagaagccgcgcgccgcttc
gccccggacgcgcgcctgttcgcgctcgacggcctgcttcccggagcggcgtccgttttc
agcgccaacgatatcgcacccgttctgaccagcctcgaagaactggccgtgtggtccgcc
gaagccacgcgcaccggaaagcgcttgccagccgggctccagatcgacagcgggcttaac
cggctgggcctctcggaagacgacgtgcgcacgctcgccagcgcccccgcacgcctcgac
ggcatcgacctccgcctcgtcatgagccacctggcctgcgccgacgatcccgcccacccg
cacaacgaaacccagcggtccaacttcgaccgcctgcgcacgcttcttccgccaacgccc
gcaagcctcgccgcgtccgacgggctgatgctcggcgcgcgcttccattacgacctcgtg
cgccccggctacgcgctctatggcggccaggccttccaaggcggtccgacgcccgttcgg
cccgccgtgaccgtggaagcgcgcgtacttcaggtgcgcacgctctcgcccggagatccg
gtcggctactcggccacgtggcgcgccgcacgtccgacgcggcttgcggtcatctcggcg
gggtatgcggacggcatcgcgcgggcgttgagcgcaagcacggagcgcgaaggcggcgtc
atcgcgatccacggcgaggcagcccccatcgtcgggcgcgtctccatggatctcatcacc
gccgacgtgacggacatcgcagcggccatcgcccccggcgatctcgccaccctcgtcggc
cccggcctcaccgtcgaagccatgggacaggctggcggaaccatcggttacgaggtgctc
acgcgtctcggcacgcgcttcgcgcggcattacgtgggcggaggcggctaa

DBGET integrated database retrieval system