KEGG   Hyphomicrobium nitrativorans: W911_16110Help
Entry
W911_16110        CDS       T02943                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hni  Hyphomicrobium nitrativorans
Pathway
hni00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:hni00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    W911_16110
Enzymes [BR:hni01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     W911_16110
Transporters [BR:hni02000]
 Other Transporters
  Pores ion channels [TC:1]
   W911_16110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C_3 GST_C
Motif
Other DBs
NCBI-ProteinID: AHB49584
UniProt: V5SI15
LinkDB All DBs
Position
3353319..3353924
Genome map
AA seq 201 aa AA seqDB search
MLTLYHNPQSRSTTVHTMLHEIGEPFELVAVDLKAGEQKSDAFLKINPMGKIPVLLDGDL
IVTETPAILTYLADRYPDAGLAPAIDDPDRAAYLRWLFFAGSCFEPAAIDKALNRETPSS
MGGWGTPDDVFRTLAAALKPGPWLLGERFTAADVMMGSGVAYMLGFKIIPEWPEFVDYAA
RIEARPARQAAKAADEARAGG
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgctcacgctctatcacaacccgcaatcgcgctcgacgaccgtgcataccatgctgcac
gagatcggggagccgttcgaactcgtcgccgtagatctcaaggcgggcgagcaaaagtcg
gacgcgtttttgaagatcaatccgatgggcaagatccctgttctgctcgacggcgatttg
atcgtcacggaaacgcctgcaattctcacctatctcgccgataggtatccggatgccggt
ttggcgccggctatcgacgacccggaccgcgcagcctacttgcgctggctgttcttcgcg
ggaagctgcttcgagcctgccgcaatcgacaaggcgctcaacagagaaacgccttcctcc
atgggtggatggggcacgcccgacgacgtgttccgcacgctggcggccgccttgaagccc
gggccgtggttgctcggcgagcggttcacggccgcggacgtcatgatgggctcgggtgtc
gcctacatgctggggttcaagatcattcccgagtggccggaattcgtcgattacgcggcg
cggatcgaggcacgccccgcaaggcaggccgccaaagctgccgacgaggcgcgcgcgggc
ggctaa

DBGET integrated database retrieval system