KEGG   Haliangium ochraceum: Hoch_3330Help
Entry
Hoch_3330         CDS       T01103                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
hoh  Haliangium ochraceum
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Hoch_3330
Enzymes [BR:hoh01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Hoch_3330
DNA repair and recombination proteins [BR:hoh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Hoch_3330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4605709..4608399
Genome map
AA seq 896 aa AA seqDB search
MSGKRHGGRGLETYRAKRDPAATPEPFGGRVGGPEWRAAAGRAAPFVVHKHAARRLHYDL
RLAMDGVLLSWAVPRGPSLSSSDRRLAVQVEDHPLDYAWFEGVIPAGEYGAGASIVWDAG
SWLPSADPRRGLEDGALEFELFGYKLRGGFRLVRTGKRGQGAGKEWLLLKRRDGFADDDA
VLVESSVLSGLTVEELGAGPTRAQQAAAALDALAAPARRLRVDQVAPMLCELADGPFSDP
DWVYELKYDGYRMLAGIADGEVSLRLRSGRDATALFPEIVRALRRWPLADAVLDGEVVAL
DEAGRPVFQRLQPRNRPAGADEIERAAALAPVSYAVFDLLACEGRDLRALPLLARKQVLA
PLVPARGPVRYADHVEAQGEAFFDQVVAHGLEGVVAKRASSSYQGRRSDEWRKIRQIRHG
RFVIVGTTSPRGGRAGFGSLHLAAWDHGWVYVGRVGTGFDARALREIAARLEALPRWRPS
FPAPSSPGRRDRWLAPTLVCEVGYQDVSDDGRLRLPRFVGLCPEVAPEDCPPPRSARALA
DARASGFATATADADADADAEDTDAVRQAAENPAGAREPAASGADQDGIDDRAPRGQVSN
PDKLYFPAGAGRRAHSKGALVAYYRAVAPWMLPYLRDRPLALVRFPEGIEGPSFFQKDAP
AWVPAWLRTETLWSPQAQRTLRYIICDSEDALAFVANLGAIAVHTWSARIGALGRPDWAI
LDLDPKGAPFVHVVEIARALRALCRALDLACFVKTSGATGLHVLIPLGGSCTHEQARTLA
QLLAQLVCAEHPAIATTARPLAARGGRVYIDCVQNGQGRLLVAPLSVRARPGAPVSMPLR
WRELSPKLDPARFTIDKAVARLRRMDPEPFAGLLDTRPDLARALALLEERLGLSRG
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atgtccgggaagcgacacggcgggcggggcctcgagacctatcgcgccaagcgcgacccc
gcggccacgccggagccgttcggcgggcgggtcggtggtcccgagtggcgcgcggcggct
ggccgagcggcgcccttcgtggtccacaagcacgcggcgcggcgtctgcactacgatctg
cgcctggccatggacggcgtgctgctgtcctgggcggtgcccagagggccctcgctgtcg
tcgtcggacaggcgtctggccgtccaggtcgaggaccatccgctcgactacgcctggttc
gagggcgtcatcccagccggggaatacggcgccggcgccagcatcgtgtgggacgcgggc
tcgtggctgccgagcgcggatccgcgccgcgggctcgaggacggcgcgctcgagttcgag
ctctttggctacaagctgcgcggcggcttccgcctggtgcgcaccggcaaacgcggccag
ggcgcgggcaaggagtggctgctgctcaagcgccgcgacggcttcgccgatgacgacgcg
gtcctggtcgagagctcggtgctgtcggggctcacggtcgaggagctgggcgccgggccg
acccgggcccagcaggccgcggccgcgctcgacgcgctcgcggcgccggcgcggcggctg
cgcgtggaccaggtggcgccgatgctgtgcgagctggccgacgggccgttctcggatccc
gactgggtgtacgaactcaaatacgacggctaccgcatgctggccggcatcgccgatggc
gaggtcagcctgcgcttgcgcagcggccgcgacgccaccgcgctgttccccgaaatcgtc
cgcgcgctgcgccgctggccgctggccgacgcggtgctcgacggcgaggtggtggccctc
gacgaggccgggcggccggtgtttcagcgcctgcagccgcgcaatcgccccgcgggcgcg
gacgagatcgagcgcgcggccgcgctggcgccggtgagctacgcggtcttcgacctgctc
gcctgcgagggccgcgatctgcgcgcgctgccgctgctggcgcgcaagcaggtgctggcg
ccgctggtgcccgcgcgcggtccggtgcgctacgccgaccacgtcgaggcccagggcgag
gcgtttttcgaccaggtggtcgcccacggcctcgagggcgtggtggccaagcgcgcgtcc
tcgagctaccagggccggcgcagcgacgagtggcgcaagatccggcagattcgccacggc
cgcttcgtcatcgtcggcaccacctcgcccaggggcgggcgcgcggggtttggctcgctg
cacctggccgcctgggaccacggctgggtgtacgtgggccgcgtgggcacgggcttcgac
gcgcgcgcgctgcgcgagatcgcggcccgactcgaggccctgccgcggtggcggccgagc
ttcccggcgccgtcgtcgcccggccggcgcgaccgctggctcgcgccgacgctggtgtgc
gaggtcggctatcaggacgtgtccgacgatggccgcctgcggctgccgcgcttcgtcggg
ctgtgccccgaggtcgcgcccgaggactgtccgccgccgcgctcggcgcgcgcgctggcc
gacgctcgcgcctccgggttcgctaccgcgaccgccgacgccgacgccgacgccgacgcc
gaggatacagacgcggtccgccaggctgccgagaacccggccggggcgcgcgagccggcc
gccagcggcgcggaccaagacggcatcgacgaccgggcgccgcgggggcaggtgagcaac
ccggacaagctctactttcccgccggcgcgggccggcgcgcgcacagcaagggcgcgttg
gtcgcctactaccgggccgtcgcgccgtggatgctgccgtacttgcgcgatcgcccgcta
gccctggtgcgcttccccgagggcatcgaggggccgtcgttcttccaaaaggacgcgccc
gcctgggtgccggcgtggctgcgcaccgagacgctgtggagcccgcaggcccagcgcacg
ctgcgctacatcatctgcgacagcgaggacgcgctggcctttgtggccaatctcggcgcc
atcgccgtgcacacctggtcggcgcgcatcggcgcgctgggccgccccgactgggccatc
ctggatctcgaccccaagggcgcgcccttcgtccacgtggtcgaaatcgcccgggcgttg
cgcgcgctgtgccgcgcgctcgacctggcgtgcttcgtcaagaccagcggcgccaccggg
ctgcacgtgctgatcccgctcggcggcagttgcacgcacgagcaagcgcgcaccctggcc
cagctcctggcccagctcgtgtgcgccgagcatcccgcgatcgcgaccacggcccggccg
ctggccgcgcgcggcggccgcgtgtacatcgactgtgtgcagaacggccagggccggctg
ctggtggcgccgctgagcgtgcgcgcgcggcccggggcgccggtgtcgatgccgctgcgc
tggcgcgagctctcgcccaagctcgaccccgcgcgcttcaccatcgacaaggccgtcgcc
cggctgcggcgcatggacccggagcccttcgccggtctgctcgacacccgacccgacctg
gcgcgcgcgctggcgctgctcgaggagcggctcgggctcagccgcggttga

DBGET integrated database retrieval system