KEGG   Halothermothrix orenii: Hore_03210Help
Entry
Hore_03210        CDS       T00838                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hor  Halothermothrix orenii
Pathway
hor00010  Glycolysis / Gluconeogenesis
hor00030  Pentose phosphate pathway
hor00051  Fructose and mannose metabolism
hor00052  Galactose metabolism
hor00680  Methane metabolism
hor01100  Metabolic pathways
hor01110  Biosynthesis of secondary metabolites
hor01120  Microbial metabolism in diverse environments
hor01130  Biosynthesis of antibiotics
hor01200  Carbon metabolism
hor01230  Biosynthesis of amino acids
hor03018  RNA degradation
Module
hor_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hor00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hore_03210
   00030 Pentose phosphate pathway
    Hore_03210
   00051 Fructose and mannose metabolism
    Hore_03210
   00052 Galactose metabolism
    Hore_03210
  Energy metabolism
   00680 Methane metabolism
    Hore_03210
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Hore_03210
Enzymes [BR:hor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Hore_03210
Protein phosphatases and associated proteins [BR:hor01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Hore_03210
Messenger RNA biogenesis [BR:hor03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Hore_03210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ACL69082
JGI: Hore0321
UniProt: B8D1K5
LinkDB All DBs
Position
329307..330305
Genome map
AA seq 332 aa AA seqDB search
MKKIGVLTSGGDAPGMNAAIRSVVRTGIYHGLDVVGIRRGYAGLIEGDFYLMDRGSVADI
IQRGGTILLSARCEEFKTEEGRQKALKKMKEEGIEGLVVIGGDGSFRGAEKVSKELGIPA
IGIPGTIDNDLACTDFTIGFDTAMNTIIDTINKIRDTATSHERTFVVETMGRRSGFLTLM
AGLAGGAESILIPEIDFDLDDVSQKLKKGYERGKLHSIILVAEGVGDDFSTNRDINHSKA
FVIGKQIAEKTGLETRVIILGHIQRGGSPTAMDRILASRMGSKAVELLLASESNKMVGYV
NNKLVTCDISEALSKEKQVEKDVYKLANILSM
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaataggtgtattaacaagcggtggagatgccccgggaatgaatgctgccatc
aggtctgtggttagaactggtatatatcacggacttgatgttgttgggataagaaggggt
tatgccggtttaatcgaaggtgatttttatttaatggacaggggttctgtggccgatatt
attcaacgtgggggaactattctcctttcagcccgttgtgaagaatttaaaacagaagaa
ggccggcaaaaggcccttaaaaaaatgaaagaagaaggtattgaaggcctggttgttatt
ggtggtgacggctccttcaggggagcagaaaaagtaagcaaagagctgggtattcctgca
attggaattccgggtactatagataatgatctggcctgtactgattttactattggattt
gatactgccatgaatactattatcgatactatcaataaaatcagggatacggctacttcc
catgaaaggacctttgttgtagaaacaatgggacgcagatccgggtttttaacccttatg
gccggtctagccggtggtgccgaatccattttaatacctgaaattgactttgatctggat
gatgtttcccagaaattaaaaaaaggttatgaacgtggtaaactgcatagtattattctg
gtagctgaaggtgttggtgatgacttcagtaccaaccgtgatataaaccacagtaaggcc
tttgttattggcaagcagatagctgaaaaaacgggactcgaaacaagggtcattatcctt
ggtcatattcagaggggtggctctcctacagctatggaccggattctggcaagtcgaatg
gggtctaaagcggtagaattgctcctggctagtgaatctaataaaatggtaggatatgtt
aataataaacttgtaacctgtgatattagcgaagccctcagtaaggaaaaacaggtcgaa
aaagatgtatataagctagccaatattctttctatgtaa

DBGET integrated database retrieval system