KEGG   Helicobacter pylori PeCan4: HPPC_04750Help
Entry
HPPC_04750        CDS       T01322                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
hpc  Helicobacter pylori PeCan4
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hpc00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    HPPC_04750
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    HPPC_04750
Enzymes [BR:hpc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     HPPC_04750
Peptidoglycan biosynthesis and degradation proteins [BR:hpc01011]
 Precursor biosynthesis
  Racemase
   HPPC_04750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(960305..961438)
Genome map
AA seq 377 aa AA seqDB search
MLKRASFVEVDTASLRHNFSAVKSIVPKDAHIMAVVKANAYGVGAIKASEIFLQEGANYL
GVATLDEALELRSHFSKTPILILGYSPNSNASMLIDNDLSAMIFSLEQAEVFSQMALKSQ
KRLKIHLKIDTGMHRLGLEPNFKSIETIKKIRALKGLEVEGIFTHLSNADAKIKTHAKNQ
MKAFNAFLEQLLDQKIEFQYRHAYNSAGILSLCNGNENRFLNLYRPGIMLYGFYPSNGMK
ETCPTILKNVISLKAQIVQIRSVKKGEFIGYGEHFYTNEETLVGVLALGYADGLMRALGN
RTQVAINNQLAPLIGKVCMDQCFVKLNNIQAKEGDEVILFGDKSAKANDASEIAALLNTI
PYETISTLSKRLERVYI
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaagggcgagttttgtagaagtggataccgcttctttaaggcataattttagt
gcagtcaaaagcattgtccctaaagacgcccacatcatggcggttgtcaaggcgaacgct
tatggggtgggagccataaaagcgagcgaaattttcttacaagaaggggctaattattta
ggggtagcgaccttagatgaagctttagagttgcgctctcatttttctaaaacccccatt
ttgattttaggctatagccctaattctaacgcttccatgctgattgataacgatttgagt
gctatgatttttagccttgaacaagcggaagttttttctcaaatggctttaaaatctcaa
aaacgcttaaaaatccatctcaaaattgataccggcatgcaccgcttgggattagagcct
aattttaaaagcatagaaaccattaaaaaaatccgcgctttaaaaggcttggaagtggaa
gggatattcacgcatttaagcaacgctgacgctaagattaaaacccatgctaaaaaccaa
atgaaagcctttaacgcttttttagaacagcttttggatcaaaaaatagagtttcaatac
cgccatgcttacaattccgccggcatcctttctttgtgtaacgggaatgaaaaccgcttc
ttaaacctctatcgcccaggaatcatgctttatggtttttacccttctaatggaatgaaa
gaaacatgcccaaccattttaaaaaatgttatcagtttaaaagctcaaatcgttcaaatc
agaagcgttaaaaaaggcgaatttattggctatggcgagcatttttacacgaatgaagaa
actttagtgggtgttttagctctagggtatgcggatgggttaatgcgcgctttaggcaat
cgcactcaagtagcgatcaataaccaattagccccccttattggcaaggtgtgcatggat
cagtgctttgtcaagctcaataatattcaagccaaagagggcgatgaggtcatcttgttt
ggggataaaagcgctaaggctaatgacgcaagcgaaatcgctgcgcttttaaacaccatt
ccttatgaaaccatcagcaccctatccaaacgcttggagcgcgtctatatttaa

DBGET integrated database retrieval system