KEGG   Helicobacter pylori 2017: hp2017_0924Help
Entry
hp2017_0924       CDS       T01913                                 

Gene name
alr
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
hpq  Helicobacter pylori 2017
Pathway
hpq00473  D-Alanine metabolism
hpq01100  Metabolic pathways
hpq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hpq00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    hp2017_0924 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    hp2017_0924 (alr)
Enzymes [BR:hpq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     hp2017_0924 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:hpq01011]
 Precursor biosynthesis
  Racemase
   hp2017_0924 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADZ50028
LinkDB All DBs
Position
complement(939540..940673)
Genome map
AA seq 377 aa AA seqDB search
MLKRASFVEVNTASLRHNFNAVKSIVPKDACVMAVVKANAYGAGALKASEIFLQEGANYL
GVATLDEALELRSHFSKTPILILGYNPNANASMLIDNDLSAMVFSLEQAEVFSQMALKSQ
KRLKIHLKIDTGMHRLGLEPTFKSIEIVKKIRALKGLEVEGIFTHLSNADANIKTHAKNQ
MKAFNAFLEQLLNQKIEFKYRHAYNSAGILSLCNGNENRLLNLYRPGIMLYGFYPSNEMK
ESSQTILKNVISLKARIVQIKRVKKGEFIGYGEHFYTNEETLVGVLALGYADGLVRALGN
RIQVAINNQLAPLIGKVCMDQCFVKLNGIEAKEGDEVILFGDKSAKANDASEIAALLNTI
PYETISTLSKRLERVYI
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaagggcgagttttgtagaagtgaataccgcttctttaaggcataattttaat
gcggtcaaaagcattgtccctaaagacgcttgtgtcatggcggttgttaaggcgaacgct
tatggggcgggggcattaaaagcgagcgaaatttttttacaagaaggggctaattattta
ggagtagcgaccttagatgaagctttagaattgcgctctcatttttctaaaacccccatt
ttgattttaggctataaccctaatgctaacgcttccatgctgattgataacgatttgagc
gctatggtttttagccttgaacaagcggaagttttttctcaaatggctttaaagtctcaa
aaacgcttaaaaattcatcttaaaattgataccggcatgcaccgcttgggtttagagcct
acttttaaaagcatagaaatcgttaaaaaaatccgcgctttaaagggcttggaagtggaa
gggatattcacgcatttaagcaacgctgatgctaacattaaaacccatgctaaaaaccag
atgaaagcctttaacgcttttttagaacagcttttaaatcaaaaaatagaatttaaatac
cgccatgcttataattccgccggcatcctttctttgtgtaacgggaatgaaaatcgtttg
ttaaacctctatcgcccaggcatcatgctctatggtttttacccttctaatgaaatgaaa
gagtcgtctcaaacgatattaaaaaatgttatcagtttaaaagcgcgaatcgttcaaatc
aaacgagtcaaaaaaggcgaatttattggatatggcgagcatttttacaccaatgaagaa
actttagtgggcgttttagctctagggtatgcggacgggttggtgcgcgctttgggcaat
cgcattcaagtagcgatcaataaccaattagcccctcttattggcaaggtgtgcatggat
cagtgctttgtcaaacttaatggtattgaagccaaagagggcgatgaggtcatcttgttt
ggggataaaagcgctaaggctaatgacgcaagcgagattgctgcacttttaaacaccatt
ccttatgaaaccatcagcactttatccaaacgcttggagcgtgtctatatttaa

DBGET integrated database retrieval system