KEGG   Homo sapiens (human): 1285Help
Entry
1285              CDS       T01001                                 

Gene name
COL4A3
Definition
collagen, type IV, alpha 3 (Goodpasture antigen)
Orthology
K06237  
collagen, type IV, alpha
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Protein digestion and absorption
Amoebiasis
Pathways in cancer
Small cell lung cancer
Disease
H00581  
Alport syndrome
H00582  
Benign familial hematuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    1285 (COL4A3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    1285 (COL4A3)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    1285 (COL4A3)
 Organismal Systems
  Digestive system
   04974 Protein digestion and absorption
    1285 (COL4A3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1285 (COL4A3)
   05222 Small cell lung cancer
    1285 (COL4A3)
  Infectious diseases
   05146 Amoebiasis
    1285 (COL4A3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   1285 (COL4A3)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  1285 (COL4A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
2q36-q37
AA seq 1670 aa AA seqDB search
MSARTAPRPQVLLLPLLLVLLAAAPAASKGCVCKDKGQCFCDGAKGEKGEKGFPGPPGSP
GQKGFTGPEGLPGPQGPKGFPGLPGLTGSKGVRGISGLPGFSGSPGLPGTPGNTGPYGLV
GVPGCSGSKGEQGFPGLPGTLGYPGIPGAAGLKGQKGAPAKEEDIELDAKGDPGLPGAPG
PQGLPGPPGFPGPVGPPGPPGFFGFPGAMGPRGPKGHMGERVIGHKGERGVKGLTGPPGP
PGTVIVTLTGPDNRTDLKGEKGDKGAMGEPGPPGPSGLPGESYGSEKGAPGDPGLQGKPG
KDGVPGFPGSEGVKGNRGFPGLMGEDGIKGQKGDIGPPGFRGPTEYYDTYQEKGDEGTPG
PPGPRGARGPQGPSGPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGRPGKDAMGTPGSP
GCAGSPGLPGSPGPPGPPGDIVFRKGPPGDHGLPGYLGSPGIPGVDGPKGEPGLLCTQCP
YIPGPPGLPGLPGLHGVKGIPGRQGAAGLKGSPGSPGNTGLPGFPGFPGAQGDPGLKGEK
GETLQPEGQVGVPGDPGLRGQPGRKGLDGIPGTPGVKGLPGPKGELALSGEKGDQGPPGD
PGSPGSPGPAGPAGPPGYGPQGEPGLQGTQGVPGAPGPPGEAGPRGELSVSTPVPGPPGP
PGPPGHPGPQGPPGIPGSLGKCGDPGLPGPDGEPGIPGIGFPGPPGPKGDQGFPGTKGSL
GCPGKMGEPGLPGKPGLPGAKGEPAVAMPGGPGTPGFPGERGNSGEHGEIGLPGLPGLPG
TPGNEGLDGPRGDPGQPGPPGEQGPPGRCIEGPRGAQGLPGLNGLKGQQGRRGKTGPKGD
PGIPGLDRSGFPGETGSPGIPGHQGEMGPLGQRGYPGNPGILGPPGEDGVIGMMGFPGAI
GPPGPPGNPGTPGQRGSPGIPGVKGQRGTPGAKGEQGDKGNPGPSEISHVIGDKGEPGLK
GFAGNPGEKGNRGVPGMPGLKGLKGLPGPAGPPGPRGDLGSTGNPGEPGLRGIPGSMGNM
GMPGSKGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPGYSEGTRPGPPGPTGDPGLPGDMG
KKGEMGQPGPPGHLGPAGPEGAPGSPGSPGLPGKPGPHGDLGFKGIKGLLGPPGIRGPPG
LPGFPGSPGPMGIRGDQGRDGIPGPAGEKGETGLLRAPPGPRGNPGAQGAKGDRGAPGFP
GLPGRKGAMGDAGPRGPTGIEGFPGPPGLPGAIIPGQTGNRGPPGSRGSPGAPGPPGPPG
SHVIGIKGDKGSMGHPGPKGPPGTAGDMGPPGRLGAPGTPGLPGPRGDPGFQGFPGVKGE
KGNPGFLGSIGPPGPIGPKGPPGVRGDPGTLKIISLPGSPGPPGTPGEPGMQGEPGPPGP
PGNLGPCGPRGKPGKDGKPGTPGPAGEKGNKGSKGEPGPAGSDGLPGLKGKRGDSGSPAT
WTTRGFVFTRHSQTTAIPSCPEGTVPLYSGFSFLFVQGNQRAHGQDLGTLGSCLQRFTTM
PFLFCNVNDVCNFASRNDYSYWLSTPALMPMNMAPITGRALEPYISRCTVCEGPAIAIAV
HSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRG
TCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKKRH
NT seq 5013 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcccggaccgcccccaggccgcaggtgctcctgctgccgctcctgctggtgctc
ctggcggcggcgcccgcagccagcaagggttgtgtctgtaaagacaaaggccagtgcttc
tgtgacggggccaaaggggagaagggggagaagggctttcctggaccccccggttctcct
ggccagaaaggattcacaggtcctgaaggcttgcctggaccgcagggacccaagggcttt
ccaggacttccaggactcacgggttccaaaggtgtaaggggaataagtggattgccagga
ttttctggttctcctggacttccaggcaccccaggcaataccgggccttacggacttgtc
ggtgtaccaggatgcagtggttctaagggtgagcaggggtttccaggactcccagggaca
ctgggctacccagggatcccgggtgctgctggtttgaaaggacaaaagggtgctcctgct
aaagaagaagatatagaacttgatgcaaaaggcgaccccgggttgccaggggctccagga
ccccagggtttgccaggccctccaggttttcctgggcctgttggcccacctggtcctccg
ggattctttggctttccaggagccatgggacctagaggacctaagggtcacatgggtgaa
agagtgataggacataaaggagagcggggtgtgaaagggttaacaggacccccgggacca
ccaggaacagttattgtgaccctaactggcccagataacagaacggacctcaagggggaa
aagggagacaagggagcaatgggcgagcctggacctcctggaccctcaggactgcctgga
gaatcatatggatctgaaaagggtgctcctggagaccctggcctgcagggaaaacccgga
aaagatggtgttcctggcttccctggaagtgagggagtcaagggcaacaggggtttccct
gggttaatgggtgaagatggcattaagggacagaaaggggacattggccctccaggattt
cgtggtccaacagaatattatgacacataccaggaaaagggagatgaaggcactccaggc
ccaccagggcccagaggagctcgtggcccacaaggtcccagtggtccccccggagttcct
ggaagtcctggatcatcaaggcctggcctcagaggagcccctggatggccaggcctgaaa
ggaagtaaaggggaacgaggccgcccaggaaaggatgccatggggactcctgggtcccca
ggttgtgctggttcaccaggtcttccaggatcaccgggacctccaggaccgccaggtgac
atcgtttttcgcaagggtccacctggagatcacggactgccaggctatctagggtctcca
ggaatcccaggagttgatgggcccaaaggagaaccaggcctcctgtgtacacagtgccct
tatatcccagggcctcccggtctcccaggattgccagggttacatggtgtaaaaggaatc
ccaggaagacaaggcgcagctggcttgaaaggaagcccagggtccccaggaaatacaggt
cttccaggatttccaggtttcccaggtgcccagggtgacccaggacttaaaggagaaaaa
ggtgaaacacttcagcctgaggggcaagtgggtgtcccaggtgacccggggctcagaggc
caacctgggagaaagggcttggatggaattcctggaactccgggagtgaaaggattacca
ggacctaaaggcgaactggctctgagtggtgagaaaggggaccaaggtcctccaggggat
cctggctcccctgggtccccaggacctgcaggaccagctggaccacctggctacggaccc
caaggagaacctggtctccagggcacgcaaggagttcctggagcccccggaccacccgga
gaagccggccctaggggagagctcagtgtttcaacaccagttccaggcccaccaggacct
ccagggccccctggccatcctggcccccaaggtccacctggtatccctggatccctgggg
aaatgtggagatcctggtcttccagggcctgatggtgaaccaggaattccaggaattgga
tttcctgggcctcctggacctaagggagaccaaggttttccaggtacaaaaggatcactg
ggttgtcctggaaaaatgggagagcctgggttacctggaaagccaggcctcccaggagcc
aagggagaaccagcagtagccatgcctggaggaccaggaacaccaggttttccaggagaa
agaggcaattctggggaacatggagaaattggactccctggacttccaggtctccctgga
actccaggaaatgaagggcttgatggaccacgaggagatccagggcagcctggaccacct
ggagaacaaggacccccaggaaggtgcatagagggtcccaggggagcccaaggacttcca
ggcttaaatggattgaaagggcaacaaggcagaagaggtaaaacggggccaaagggagac
ccaggaattccaggcttggatagatcaggatttcctggagaaactggatcaccaggaatt
ccaggtcatcaaggtgaaatgggaccactgggtcaaagaggatatccaggaaatccggga
attttagggccaccaggtgaagatggagtgattgggatgatgggctttcctggagccatt
ggccctccagggccccctgggaacccaggcacaccagggcagagggggagccctggaatt
ccaggagtaaagggccagagaggaaccccaggagccaagggggaacaaggagataaagga
aatcccgggccttcagagatatcccacgtaataggggacaaaggagaaccaggtctcaaa
ggattcgcaggaaatccaggtgagaaaggaaacagaggcgttccagggatgccaggttta
aagggcctcaaaggactacccggaccagcaggaccaccaggccccagaggagatttgggc
agcactgggaatcctggagaaccaggactgcgtggtataccaggaagcatggggaacatg
ggcatgccaggttctaaaggaaaaaggggaactttgggattcccaggtcgagcaggaaga
ccaggcctcccaggtattcatggtctccagggagataagggagagccaggttattcagaa
ggtacaaggccaggaccaccgggaccaacgggggatccaggactgccgggtgatatggga
aagaaaggagaaatggggcaacctggcccacctggacatttggggcctgctggacctgag
ggagcccctggaagtcctggaagtcctggcctcccaggaaagccaggtcctcatggtgat
ttgggttttaaaggaatcaaaggcctcctgggccctccaggaatcagaggccctccaggt
cttccaggatttccaggatctcctggaccaatgggtataagaggtgaccaaggacgtgat
ggaattcctggtccagccggagaaaagggagaaacgggtttattgagggcccctccaggc
ccaagagggaaccctggtgctcaaggagccaaaggagacaggggagccccaggttttcct
ggcctcccgggcagaaaaggggccatgggagatgctggacctcgaggacccacaggcata
gaaggattcccagggccaccaggtctgcccggtgcaattatccctggccagacaggaaat
cgtggtccaccaggctcaagaggaagcccaggtgcgcctggtccccctggacctccaggg
agtcatgtaataggcataaaaggagacaaagggtctatgggccaccctggcccaaaaggt
ccacctggaactgcaggagacatgggaccaccaggtcgtctgggagcaccaggtactcca
ggtcttccaggacccagaggtgatcctggattccaggggtttccaggcgtgaaaggagaa
aagggtaatcctggatttctaggatccattggacctccaggaccaattgggccaaaagga
ccacctggtgtacgtggagaccctggcacacttaagattatctcccttccaggaagccca
gggccacctggcacacctggagaaccagggatgcagggagaacctgggccaccagggcca
cctggaaacctaggaccctgtgggccaagaggtaagccaggcaaggatggaaaaccagga
actcctggaccagctggagaaaaaggcaacaaaggttctaaaggagagccaggaccagct
ggatcagatggattgccaggtttgaaaggaaaacgtggagacagtggatcacctgcaacc
tggacaacgagaggctttgtcttcacccgacacagtcaaaccacagcaattccttcatgt
ccagaggggacagtgccactctacagtgggttttcttttctttttgtacaaggaaatcaa
cgagcccacggacaagaccttggaactcttggcagctgcctgcagcgatttaccacaatg
ccattcttattctgcaatgtcaatgatgtatgtaattttgcatctcgaaatgattattca
tactggctgtcaacaccagctctgatgccaatgaacatggctcccattactggcagagcc
cttgagccttatataagcagatgcactgtttgtgaaggtcctgcgatcgccatagccgtt
cacagccaaaccactgacattcctccatgtcctcacggctggatttctctctggaaagga
ttttcattcatcatgttcacaagtgcaggttctgagggcaccgggcaagcactggcctcc
cctggctcctgcctggaagaattccgagccagcccatttctagaatgtcatggaagagga
acgtgcaactactattcaaattcctacagtttctggctggcttcattaaacccagaaaga
atgttcagaaagcctattccatcaactgtgaaagctggggaattagaaaaaataataagt
cgctgtcaggtgtgcatgaagaaaagacactga

DBGET integrated database retrieval system