KEGG   Homo sapiens (human): 2162Help
Entry
2162              CDS       T01001                                 

Gene name
F13A1, F13A
Definition
coagulation factor XIII, A1 polypeptide (EC:2.3.2.13)
Orthology
K03917  
coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Disease
H00945  
Factor XIII deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    2162 (F13A1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     2162 (F13A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
6p25.3-p24.3
AA seq 732 aa AA seqDB search
MSETSRTAFGGRRAVPPNNSNAAEDDLPTVELQGVVPRGVNLQEFLNVTSVHLFKERWDT
NKVDHHTDKYENNKLIVRRGQSFYVQIDFSRPYDPRRDLFRVEYVIGRYPQENKGTYIPV
PIVSELQSGKWGAKIVMREDRSVRLSIQSSPKCIVGKFRMYVAVWTPYGVLRTSRNPETD
TYILFNPWCEDDAVYLDNEKEREEYVLNDIGVIFYGEVNDIKTRSWSYGQFEDGILDTCL
YVMDRAQMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSWDNIYAYGVPPSAWTGSVDIL
LEYRSSENPVRYGQCWVFAGVFNTFLRCLGIPARIVTNYFSAHDNDANLQMDIFLEEDGN
VNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAIKH
GHVCFQFDAPFVFAEVNSDLIYITAKKDGTHVVENVDATHIGKLIVTKQIGGDGMMDITD
TYKFQEGQEEERLALETALMYGAKKPLNTEGVMKSRSNVDMDFEVENAVLGKDFKLSITF
RNNSHNRYTITAYLSANITFYTGVPKAEFKKETFDVTLEPLSFKKEAVLIQAGEYMGQLL
EQASLHFFVTARINETRDVLAKQKSTVLTIPEIIIKVRGTQVVGSDMTVTVEFTNPLKET
LRNVWVHLDGPGVTRPMKKMFREIRPNSTVQWEEVCRPWVSGHRKLIASMSSDSLRHVYG
ELDVQIQRRPSM
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaacttccaggaccgcctttggaggcagaagagcagttccacccaataactct
aatgcagcggaagatgacctgcccacagtggagcttcagggcgtggtgccccggggcgtc
aacctgcaagagtttcttaatgtcacgagcgttcacctgttcaaggagagatgggacact
aacaaggtggaccaccacactgacaagtatgaaaacaacaagctgattgtccgcagaggg
cagtctttctatgtgcagattgacttcagtcgtccatatgaccccagaagggatctcttc
agggtggaatacgtcattggtcgctacccacaggagaacaagggaacctacatcccagtg
cctatagtctcagagttacaaagtggaaagtggggggccaagattgtcatgagagaggac
aggtctgtgcggctgtccatccagtcttcccccaaatgtattgtggggaaattccgcatg
tatgttgctgtctggactccctatggcgtacttcgaaccagtcgaaacccagaaacagac
acgtacattctcttcaatccttggtgtgaagatgatgctgtgtatctggacaatgagaaa
gaaagagaagagtatgtcctgaatgacatcggggtaattttttatggagaggtcaatgac
atcaagaccagaagctggagctatggtcagtttgaagatggcatcctggacacttgcctg
tatgtgatggacagagcacaaatggacctctctggaagagggaatcccatcaaagtcagc
cgtgtggggtctgcaatggtgaatgccaaagatgacgaaggtgtcctcgttggatcctgg
gacaatatctatgcctatggcgtccccccatcggcctggactggaagcgttgacattcta
ttggaataccggagctctgagaatccagtccggtatggccaatgctgggtttttgctggt
gtctttaacacatttttacgatgccttggaataccagcaagaattgttaccaattatttc
tctgcccatgataatgatgccaatttgcaaatggacatcttcctggaagaagatgggaac
gtgaattccaaactcaccaaggattcagtgtggaactaccactgctggaatgaagcatgg
atgacaaggcctgaccttcctgttggatttggaggctggcaagctgtggacagcaccccc
caggaaaatagcgatggcatgtatcggtgtggccccgcctcggttcaagccatcaagcac
ggccatgtctgcttccaatttgatgcaccttttgtttttgcagaggtcaacagcgacctc
atttacattacagctaagaaagatggcactcatgtggtggaaaatgtggatgccacccac
attgggaaattaattgtgaccaaacaaattggaggagatggcatgatggatattactgat
acttacaaattccaagaaggtcaagaagaagagagattggccctagaaactgccctgatg
tacggagctaaaaagcccctcaacacagaaggtgtcatgaaatcaaggtccaacgttgac
atggactttgaagtggaaaatgctgtgctgggaaaagacttcaagctctccatcaccttc
cggaacaacagccacaaccgttacaccatcacagcttatctctcagccaacatcaccttc
tacaccggggtcccgaaggcagaattcaagaaggagacgttcgacgtgacgctggagccc
ttgtccttcaagaaagaggcggtgctgatccaagccggcgagtacatgggtcagctgctg
gaacaagcgtccctgcacttctttgtcacagctcgcatcaatgagaccagggatgttctg
gccaagcaaaagtccaccgtgctaaccatccctgagatcatcatcaaggtccgtggcact
caggtagttggttctgacatgactgtgacagttgagtttaccaatcctttaaaagaaacc
ctgcgaaatgtctgggtacacctggatggtcctggagtaacaagaccaatgaagaagatg
ttccgtgaaatccggcccaactccaccgtgcagtgggaagaagtgtgccggccctgggtc
tctgggcatcggaagctgatagccagcatgagcagtgactccctgagacatgtgtatggc
gagctggacgtgcagattcaaagacgaccttccatgtga

DBGET integrated database retrieval system