KEGG   Homo sapiens (human): 2902Help
Entry
2902              CDS       T01001                                 

Gene name
GRIN1, GluN1, MRD8, NMDA1, NMDAR1, NR1
Definition
glutamate receptor, ionotropic, N-methyl D-aspartate 1
Orthology
K05208  
glutamate receptor ionotropic, NMDA 1
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Long-term potentiation
Glutamatergic synapse
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Cocaine addiction
Amphetamine addiction
Nicotine addiction
Alcoholism
Disease
H00773  
Autosomal dominant mental retardation
Drug target
Ketamine: 
Esketamine: 
Ketobemidone: 
Flupirtine: 
Amantadine: 
Memantine: 
Acamprosate: 
Methadone: 
Levomethadone: 
Dextromethorphan, combinations: 
Dextromethorphan: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2902 (GRIN1)
   04015 Rap1 signaling pathway
    2902 (GRIN1)
   04020 Calcium signaling pathway
    2902 (GRIN1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2902 (GRIN1)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    2902 (GRIN1)
   04720 Long-term potentiation
    2902 (GRIN1)
  Environmental adaptation
   04713 Circadian entrainment
    2902 (GRIN1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    2902 (GRIN1)
   05014 Amyotrophic lateral sclerosis (ALS)
    2902 (GRIN1)
   05016 Huntington's disease
    2902 (GRIN1)
  Substance dependence
   05030 Cocaine addiction
    2902 (GRIN1)
   05031 Amphetamine addiction
    2902 (GRIN1)
   05033 Nicotine addiction
    2902 (GRIN1)
   05034 Alcoholism
    2902 (GRIN1)
Ion channels [BR:hsa04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), NMDA
   2902 (GRIN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
9q34.3
AA seq 885 aa AA seqDB search
MSTMRLLTLALLFSCSVARAACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQL
NATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG
LTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRL
ETLLEERESKAEKVLQFDPGTKNVTALLMEAKELEARVIILSASEDDAATVYRAAAMLNM
TGSGYVWLVGEREISGNALRYAPDGILGLQLINGKNESAHISDAVGVVAQAVHELLEKEN
ITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNRK
LVQVGIYNGTHVIPNDRKIIWPGGETEKPRGYQMSTRLKIVTIHQEPFVYVKPTLSDGTC
KEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVA
DGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTI
LVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDA
LTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRP
EERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQA
VRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSH
ENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRH
KDARRKQMQLAFAAVNVWRKNLQQYHPTDITGPLNLSDPSVSTVV
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccatgcgcctgctgacgctcgccctgctgttctcctgctccgtcgcccgtgcc
gcgtgcgaccccaagatcgtcaacattggcgcggtgctgagcacgcggaagcacgagcag
atgttccgcgaggccgtgaaccaggccaacaagcggcacggctcctggaagattcagctc
aatgccacctccgtcacgcacaagcccaacgccatccagatggctctgtcggtgtgcgag
gacctcatctccagccaggtctacgccatcctagttagccatccacctacccccaacgac
cacttcactcccacccctgtctcctacacagccggcttctaccgcatacccgtgctgggg
ctgaccacccgcatgtccatctactcggacaagagcatccacctgagcttcctgcgcacc
gtgccgccctactcccaccagtccagcgtgtggtttgagatgatgcgtgtctacagctgg
aaccacatcatcctgctggtcagcgacgaccacgagggccgggcggctcagaaacgcctg
gagacgctgctggaggagcgtgagtccaaggcagagaaggtgctgcagtttgacccaggg
accaagaacgtgacggccctgctgatggaggcgaaagagctggaggcccgggtcatcatc
ctttctgccagcgaggacgatgctgccactgtataccgcgcagccgcgatgctgaacatg
acgggctccgggtacgtgtggctggtcggcgagcgcgagatctcggggaacgccctgcgc
tacgccccagacggcatcctcgggctgcagctcatcaacggcaagaacgagtcggcccac
atcagcgacgccgtgggcgtggtggcccaggccgtgcacgagctcctcgagaaggagaac
atcaccgacccgccgcggggctgcgtgggcaacaccaacatctggaagaccgggccgctc
ttcaagagagtgctgatgtcttccaagtatgcggatggggtgactggtcgcgtggagttc
aatgaggatggggaccggaagttcgccaactacagcatcatgaacctgcagaaccgcaag
ctggtgcaagtgggcatctacaatggcacccacgtcatccctaatgacaggaagatcatc
tggccaggcggagagacagagaagcctcgagggtaccagatgtccaccagactgaagatt
gtgacgatccaccaggagcccttcgtgtacgtcaagcccacgctgagtgatgggacatgc
aaggaggagttcacagtcaacggcgacccagtcaagaaggtgatctgcaccgggcccaac
gacacgtcgccgggcagcccccgccacacggtgcctcagtgttgctacggcttttgcatc
gacctgctcatcaagctggcacggaccatgaacttcacctacgaggtgcacctggtggca
gatggcaagttcggcacacaggagcgggtgaacaacagcaacaagaaggagtggaatggg
atgatgggcgagctgctcagcgggcaggcagacatgatcgtggcgccgctaaccataaac
aacgagcgcgcgcagtacatcgagttttccaagcccttcaagtaccagggcctgactatt
ctggtcaagaaggagattccccggagcacgctggactcgttcatgcagccgttccagagc
acactgtggctgctggtggggctgtcggtgcacgtggtggccgtgatgctgtacctgctg
gaccgcttcagccccttcggccggttcaaggtgaacagcgaggaggaggaggaggacgca
ctgaccctgtcctcggccatgtggttctcctggggcgtcctgctcaactccggcatcggg
gaaggcgcccccagaagcttctcagcgcgcatcctgggcatggtgtgggccggctttgcc
atgatcatcgtggcctcctacaccgccaacctggcggccttcctggtgctggaccggccg
gaggagcgcatcacgggcatcaacgaccctcggctgaggaacccctcggacaagtttatc
tacgccacggtgaagcagagctccgtggatatctacttccggcgccaggtggagctgagc
accatgtaccggcatatggagaagcacaactacgagagtgcggcggaggccatccaggcc
gtgagagacaacaagctgcatgccttcatctgggactcggcggtgctggagttcgaggcc
tcgcagaagtgcgacctggtgacgactggagagctgtttttccgctcgggcttcggcata
ggcatgcgcaaagacagcccctggaagcagaacgtctccctgtccatcctcaagtcccac
gagaatggcttcatggaagacctggacaagacgtgggttcggtatcaggaatgtgactcg
cgcagcaacgcccctgcgacccttacttttgagaacatggccggggtcttcatgctggta
gctgggggcatcgtggccgggatcttcctgattttcatcgagattgcctacaagcggcac
aaggatgctcgccggaagcagatgcagctggcctttgccgccgttaacgtgtggcggaag
aacctgcagcagtaccatcccactgatatcacgggcccgctcaacctctcagatccctcg
gtcagcaccgtggtgtga

DBGET integrated database retrieval system