KEGG   Homo sapiens (human): 2902Help
Entry
2902              CDS       T01001                                 

Gene name
GRIN1, GluN1, MRD8, NMDA1, NMDAR1, NR1
Definition
glutamate receptor, ionotropic, N-methyl D-aspartate 1
Orthology
K05208  
glutamate receptor ionotropic, NMDA 1
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Long-term potentiation
Glutamatergic synapse
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Cocaine addiction
Amphetamine addiction
Nicotine addiction
Alcoholism
Drug target
Ketamine: 
Esketamine: 
Ketobemidone: 
Flupirtine: 
Amantadine: 
Memantine: 
Acamprosate: 
Methadone: 
Levomethadone: 
Dextromethorphan, combinations: 
Dextromethorphan: 
Other: 
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:hsa04724]
Organismal Systems; Nervous system; Long-term potentiation [PATH:hsa04720]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:hsa04713]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:hsa05010]
Human Diseases; Neurodegenerative diseases; Amyotrophic lateral sclerosis (ALS) [PATH:hsa05014]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:hsa05016]
Human Diseases; Substance dependence; Cocaine addiction [PATH:hsa05030]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:hsa05031]
Human Diseases; Substance dependence; Nicotine addiction [PATH:hsa05033]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
9q34.3
AA seq 885 aa AA seqDB search
MSTMRLLTLALLFSCSVARAACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQL
NATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG
LTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRL
ETLLEERESKAEKVLQFDPGTKNVTALLMEAKELEARVIILSASEDDAATVYRAAAMLNM
TGSGYVWLVGEREISGNALRYAPDGILGLQLINGKNESAHISDAVGVVAQAVHELLEKEN
ITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNRK
LVQVGIYNGTHVIPNDRKIIWPGGETEKPRGYQMSTRLKIVTIHQEPFVYVKPTLSDGTC
KEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVA
DGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTI
LVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDA
LTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRP
EERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQA
VRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSH
ENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRH
KDARRKQMQLAFAAVNVWRKNLQQYHPTDITGPLNLSDPSVSTVV
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccatgcgcctgctgacgctcgccctgctgttctcctgctccgtcgcccgtgcc
gcgtgcgaccccaagatcgtcaacattggcgcggtgctgagcacgcggaagcacgagcag
atgttccgcgaggccgtgaaccaggccaacaagcggcacggctcctggaagattcagctc
aatgccacctccgtcacgcacaagcccaacgccatccagatggctctgtcggtgtgcgag
gacctcatctccagccaggtctacgccatcctagttagccatccacctacccccaacgac
cacttcactcccacccctgtctcctacacagccggcttctaccgcatacccgtgctgggg
ctgaccacccgcatgtccatctactcggacaagagcatccacctgagcttcctgcgcacc
gtgccgccctactcccaccagtccagcgtgtggtttgagatgatgcgtgtctacagctgg
aaccacatcatcctgctggtcagcgacgaccacgagggccgggcggctcagaaacgcctg
gagacgctgctggaggagcgtgagtccaaggcagagaaggtgctgcagtttgacccaggg
accaagaacgtgacggccctgctgatggaggcgaaagagctggaggcccgggtcatcatc
ctttctgccagcgaggacgatgctgccactgtataccgcgcagccgcgatgctgaacatg
acgggctccgggtacgtgtggctggtcggcgagcgcgagatctcggggaacgccctgcgc
tacgccccagacggcatcctcgggctgcagctcatcaacggcaagaacgagtcggcccac
atcagcgacgccgtgggcgtggtggcccaggccgtgcacgagctcctcgagaaggagaac
atcaccgacccgccgcggggctgcgtgggcaacaccaacatctggaagaccgggccgctc
ttcaagagagtgctgatgtcttccaagtatgcggatggggtgactggtcgcgtggagttc
aatgaggatggggaccggaagttcgccaactacagcatcatgaacctgcagaaccgcaag
ctggtgcaagtgggcatctacaatggcacccacgtcatccctaatgacaggaagatcatc
tggccaggcggagagacagagaagcctcgagggtaccagatgtccaccagactgaagatt
gtgacgatccaccaggagcccttcgtgtacgtcaagcccacgctgagtgatgggacatgc
aaggaggagttcacagtcaacggcgacccagtcaagaaggtgatctgcaccgggcccaac
gacacgtcgccgggcagcccccgccacacggtgcctcagtgttgctacggcttttgcatc
gacctgctcatcaagctggcacggaccatgaacttcacctacgaggtgcacctggtggca
gatggcaagttcggcacacaggagcgggtgaacaacagcaacaagaaggagtggaatggg
atgatgggcgagctgctcagcgggcaggcagacatgatcgtggcgccgctaaccataaac
aacgagcgcgcgcagtacatcgagttttccaagcccttcaagtaccagggcctgactatt
ctggtcaagaaggagattccccggagcacgctggactcgttcatgcagccgttccagagc
acactgtggctgctggtggggctgtcggtgcacgtggtggccgtgatgctgtacctgctg
gaccgcttcagccccttcggccggttcaaggtgaacagcgaggaggaggaggaggacgca
ctgaccctgtcctcggccatgtggttctcctggggcgtcctgctcaactccggcatcggg
gaaggcgcccccagaagcttctcagcgcgcatcctgggcatggtgtgggccggctttgcc
atgatcatcgtggcctcctacaccgccaacctggcggccttcctggtgctggaccggccg
gaggagcgcatcacgggcatcaacgaccctcggctgaggaacccctcggacaagtttatc
tacgccacggtgaagcagagctccgtggatatctacttccggcgccaggtggagctgagc
accatgtaccggcatatggagaagcacaactacgagagtgcggcggaggccatccaggcc
gtgagagacaacaagctgcatgccttcatctgggactcggcggtgctggagttcgaggcc
tcgcagaagtgcgacctggtgacgactggagagctgtttttccgctcgggcttcggcata
ggcatgcgcaaagacagcccctggaagcagaacgtctccctgtccatcctcaagtcccac
gagaatggcttcatggaagacctggacaagacgtgggttcggtatcaggaatgtgactcg
cgcagcaacgcccctgcgacccttacttttgagaacatggccggggtcttcatgctggta
gctgggggcatcgtggccgggatcttcctgattttcatcgagattgcctacaagcggcac
aaggatgctcgccggaagcagatgcagctggcctttgccgccgttaacgtgtggcggaag
aacctgcagcagtaccatcccactgatatcacgggcccgctcaacctctcagatccctcg
gtcagcaccgtggtgtga

DBGET integrated database retrieval system