KEGG   Homo sapiens (human): 29929Help
Entry
29929             CDS       T01001                                 

Gene name
ALG6, CDG1C
Definition
ALG6, alpha-1,3-glucosyltransferase (EC:2.4.1.267)
Orthology
K03848  
alpha-1,3-glucosyltransferase [EC:2.4.1.267]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Module
N-glycan precursor biosynthesis
Disease
H00118  
Congenital disorders of glycosylation (CDG) type I
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:hsa00510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
1p31.3
AA seq 507 aa AA seqDB search
MEKWYLMTVVVLIGLTVRWTVSLNSYSGAGKPPMFGDYEAQRHWQEITFNLPVKQWYFNS
SDNNLQYWGLDYPPLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRTTVLIAD
LLIYIPAVVLYCCCLKEISTKKKIANALCILLYPGLILIDYGHFQYNSVSLGFALWGVLG
ISCDCDLLGSLAFCLAINYKQMELYHALPFFCFLLGKCFKKGLKGKGFVLLVKLACIVVA
SFVLCWLPFFTEREQTLQVLRRLFPVDRGLFEDKVANIWCSFNVFLKIKDILPRHIQLIM
SFCSTFLSLLPACIKLILQPSSKGFKFTLVSCALSFFLFSFQVHEKSILLVSLPVCLVLS
EIPFMSTWFLLVSTFSMLPLLLKDELLMPSVVTTMAFFIACVTSFSIFEKTSEEELQLKS
FSISVRKYLPCFTFLSRIIQYLFLISVITMVLLTLMTVTLDPPQKLPDLFSVLVCFVSCL
NFLFFLVYFNIIIMWDSKSGRNQKKIS
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggagaaatggtacttgatgacagtagtggttttaataggactaacagtacgatggaca
gtgtctcttaattcttattcaggtgctggtaaaccgcctatgtttggtgattatgaagct
cagagacactggcaagaaataacttttaatttaccggtcaaacaatggtattttaacagc
agtgataacaatttacagtattggggattggattacccacctcttacagcttatcatagt
ctcctatgtgcatatgtggcaaagtttataaatccagactggattgctctccatacatca
cgtggatatgagagtcaggcacataagctcttcatgcgtacaacagttttaattgctgat
ctgctgatttacatacctgcagtggttttgtactgttgttgcttaaaagaaatctcaact
aagaaaaagattgctaatgcattatgcatcttgctgtatccaggccttattcttatagac
tatggacattttcaatataattctgtgagtcttggctttgctttgtggggtgttcttgga
atatcttgtgactgcgacctcctagggtcactggcattttgcttagctataaattataaa
cagatggaactttaccacgccttgccatttttttgctttttacttggcaagtgttttaaa
aaaggcctcaaaggaaaggggtttgtgttgctagttaagctagcttgtattgttgtggct
tccttcgttctctgctggctgccattctttacagaaagggaacaaaccctgcaggttcta
agaagactcttcccggttgatcgtggattatttgaggataaagtagccaatatttggtgc
agcttcaatgtctttctgaagattaaggatattttgccacgtcacatccaattaataatg
agcttttgttctacgtttttgagcctgcttcctgcatgcataaaattaatacttcagccc
tcttccaaaggattcaaatttacactggttagctgtgcgctatcattctttttattttct
ttccaagtacatgaaaaatccattctcttggtgtcactaccagtctgcttagttttaagt
gaaattccttttatgtctacttggtttttacttgtgtcaacatttagtatgctacctctt
ctattgaaggatgaactcctaatgccctctgttgtgacaacaatggcattttttatagct
tgtgtaacttccttttcaatatttgaaaagacttctgaagaagaactgcagttgaaatcc
ttttccatttctgtgaggaaatatcttccatgttttacatttctttccagaattatacaa
tatttgtttcttatctcagtcatcactatggtgcttctgacgttgatgactgtcacactg
gatcctcctcagaaactaccggacttgttttctgtattggtgtgttttgtatcttgcttg
aacttcctgttcttcttggtatactttaacattattattatgtgggattccaaaagtgga
agaaatcagaagaaaatcagctag

DBGET integrated database retrieval system