KEGG   Homo sapiens (human): 3320Help
Entry
3320              CDS       T01001                                 

Gene name
HSP90AA1, EL52, HEL-S-65p, HSP86, HSP89A, HSP90A, HSP90N, HSPC1, HSPCA, HSPCAL1, HSPCAL4, HSPN, Hsp89, Hsp90, LAP-2, LAP2
Definition
(RefSeq) heat shock protein 90 alpha family class A member 1
  KO
K04079  
molecular chaperone HtpG
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
PI3K-Akt signaling pathway
Antigen processing and presentation
NOD-like receptor signaling pathway
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Pathways in cancer
Prostate cancer
Drug target
Ganetespib: 
Luminespib (DG01842): 
Onalespib: 
Retaspimycin (DG01880): 
Tanespimycin: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3320 (HSP90AA1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    3320 (HSP90AA1)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    3320 (HSP90AA1)
   04612 Antigen processing and presentation
    3320 (HSP90AA1)
  Endocrine system
   04915 Estrogen signaling pathway
    3320 (HSP90AA1)
   04914 Progesterone-mediated oocyte maturation
    3320 (HSP90AA1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3320 (HSP90AA1)
   05215 Prostate cancer
    3320 (HSP90AA1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     3320 (HSP90AA1)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP90
   3320 (HSP90AA1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    3320 (HSP90AA1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    3320 (HSP90AA1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3320 (HSP90AA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 
3T0H 3T10 3WHA 2YK9 3B28 3VHA 2YI7 3VHC 2YKE 2YKJ 3O0I 4LWE 3T2S 3T1K 3B27 1BYQ 3VHD 4U93 2YEF 3EKO 3RKZ 3QTF 3R91 3R92 3HHU 4LWG 4AWQ 4EGH 4EEH 2YI0 3BMY 3BM9 4YKR 2YJW 3OWD 4NH8 4L94 4HY6 1YER 2XJX 2YKI 2YKC 2QFO 4EGK 4YKU 4XIP 4XIR 4LWH 4LWI 4L8Z 4B7P 4AWO 4FCR 3B24 3RLP 3RLR 3R4M 3R4P 1YC1 4JQL 2YE5 2YEA 2YK2 2XDU 3D0B 4LWF 4L91 3B25 3INX 1OSF 4YKY 4O05 4EGI 3QDD 2CCS 5CF0 4YKX 4W7T 4R3M 4CWN 3WQ9 3TUH 2YI6 3OW6 2QG2 1YC4 4O04 4AWP 2YJX 4XIQ 4L93 4YKT 4YKW 4YKZ 2QG0 4XIT 4O07 4CWT 4BQG 3RLQ 2YE2 2XJJ 3MNR 2XAB 3HYY 3HZ5 2WI3 3FT5 1YET 4YKQ 4O0B 2YKB 4CWP 2YE3 2XK2 3K97 3INW 3HEK 2JJC 4O09 2XDS 2XDK 2XDL 1UY8 5FND 4CWQ 4CWR 4CWF 4NH7 4L90 4BQJ 4FCP 4EFU 3R4N 3FT8 3EKR 2VCI 2H55 3OWB 2BSM 2WI2 5FNF 3B26 2YEC 2YED 2YEH 3K99 2WI5 2FWY 2FWZ 4EFT 1YC3 4FCQ 2WI6 3T0Z 5FNC 2YE7 2YE9 2YEI 2YEJ 2XHR 1YES 2XJG 2XHT 4CWS 2YE4 2YE8 2YEE 3HYZ 3HZ1 2WI1 4CWO 2YEB 3K98 2WI4 2XDX 2YI5 2YEG 2WI7 2VCJ 2YE6 3R4O 2XHX 3Q6M 3Q6N 2QF6 2K5B 2UWD 2CCT 2CCU 2BZ5 2BYH 2BYI 2BT0 1UY6 1UY7 1UY9 1UYC 1UYD 1UYE 1UYF 1UYG 1UYH 1UYI 1UYK 1UYL
Thumbnails

Jmol
Position
14q32.33
AA seq 732 aa AA seqDB search
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPM
GRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKED
KEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRN
PDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNN
IKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKC
LELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDY
CTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKT
LVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIV
TSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVK
DLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPLE
GDDDTSRMEEVD
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggaaacccagacccaagaccaaccgatggaggaggaggaggttgagacgttc
gcctttcaggcagaaattgcccagttgatgtcattgatcatcaatactttctactcgaac
aaagagatctttctgagagagctcatttcaaattcatcagatgcattggacaaaatccgg
tatgaaagcttgacagatcccagtaaattagactctgggaaagagctgcatattaacctt
ataccgaacaaacaagatcgaactctcactattgtggatactggaattggaatgaccaag
gctgacttgatcaataaccttggtactatcgccaagtctgggaccaaagcgttcatggaa
gctttgcaggctggtgcagatatctctatgattggccagttcggtgttggtttttattct
gcttatttggttgctgagaaagtaactgtgatcaccaaacataacgatgatgagcagtac
gcttgggagtcctcagcagggggatcattcacagtgaggacagacacaggtgaacctatg
ggtcgtggaacaaaagttatcctacacctgaaagaagaccaaactgagtacttggaggaa
cgaagaataaaggagattgtgaagaaacattctcagtttattggatatcccattactctt
tttgtggagaaggaacgtgataaagaagtaagcgatgatgaggctgaagaaaaggaagac
aaagaagaagaaaaagaaaaagaagagaaagagtcggaagacaaacctgaaattgaagat
gttggttctgatgaggaagaagaaaagaaggatggtgacaagaagaagaagaagaagatt
aaggaaaagtacatcgatcaagaagagctcaacaaaacaaagcccatctggaccagaaat
cccgacgatattactaatgaggagtacggagaattctataagagcttgaccaatgactgg
gaagatcacttggcagtgaagcatttttcagttgaaggacagttggaattcagagccctt
ctatttgtcccacgacgtgctccttttgatctgtttgaaaacagaaagaaaaagaacaac
atcaaattgtatgtacgcagagttttcatcatggataactgtgaggagctaatccctgaa
tatctgaacttcattagaggggtggtagactcggaggatctccctctaaacatatcccgt
gagatgttgcaacaaagcaaaattttgaaagttatcaggaagaatttggtcaaaaaatgc
ttagaactctttactgaactggcggaagataaagagaactacaagaaattctatgagcag
ttctctaaaaacataaagcttggaatacacgaagactctcaaaatcggaagaagctttca
gagctgttaaggtactacacatctgcctctggtgatgagatggtttctctcaaggactac
tgcaccagaatgaaggagaaccagaaacatatctattatatcacaggtgagaccaaggac
caggtagctaactcagcctttgtggaacgtcttcggaaacatggcttagaagtgatctat
atgattgagcccattgatgagtactgtgtccaacagctgaaggaatttgaggggaagact
ttagtgtcagtcaccaaagaaggcctggaacttccagaggatgaagaagagaaaaagaag
caggaagagaaaaaaacaaagtttgagaacctctgcaaaatcatgaaagacatattggag
aaaaaagttgaaaaggtggttgtgtcaaaccgattggtgacatctccatgctgtattgtc
acaagcacatatggctggacagcaaacatggagagaatcatgaaagctcaagccctaaga
gacaactcaacaatgggttacatggcagcaaagaaacacctggagataaaccctgaccat
tccattattgagaccttaaggcaaaaggcagaggctgataagaacgacaagtctgtgaag
gatctggtcatcttgctttatgaaactgcgctcctgtcttctggcttcagtctggaagat
ccccagacacatgctaacaggatctacaggatgatcaaacttggtctgggtattgatgaa
gatgaccctactgctgatgataccagtgctgctgtaactgaagaaatgccaccccttgaa
ggagatgacgacacatcacgcatggaagaagtagactaa

DBGET integrated database retrieval system