KEGG   Homo sapiens (human): 4843Help
Entry
4843              CDS       T01001                                 

Gene name
NOS2, HEP-NOS, INOS, NOS, NOS2A
Definition
nitric oxide synthase 2, inducible (EC:1.14.13.39)
Orthology
K13241  
nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
hsa  Homo sapiens (human)
Pathway
Arginine and proline metabolism
Metabolic pathways
Calcium signaling pathway
HIF-1 signaling pathway
Peroxisome
Salmonella infection
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Amoebiasis
Tuberculosis
Pathways in cancer
Small cell lung cancer
Disease
H00017  
Esophageal cancer
Drug target
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hsa00330]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:hsa04146]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:hsa05222]
Human Diseases; Infectious diseases; Salmonella infection [PATH:hsa05132]
Human Diseases; Infectious diseases; Pertussis [PATH:hsa05133]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:hsa05140]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
17q11.2-q12
AA seq 1153 aa AA seqDB search
MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPL
VETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIM
TPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAREMFEHICRHVRYSTNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG
RFDVVPLVLQANGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINI
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEM
LNYVLSPFYYYQVEAWKTHVWQDEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVT
ILFATETGKSEALAWDLGALFSCAFNPKVVCMDKYRLSCLEEERLLLVVTSTFGNGDCPG
NGEKLKKSLFMLKELNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLTPMGEGD
ELSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDL
SKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQ
PALVQGILERVVDGPTPHQTVRLEALDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQ
LLLQKLAQVATEEPERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL
PILKPRFYSISSSRDHTPTEIHLTVAVVTYHTRDGQGPLHHGVCSTWLNSLKPQDPVPCF
VRNASGFHLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDSQHKGVRGGRMTLVFGCRRPD
EDHIYQEEMLEMAQKGVLHAVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHKEPGHLY
VCGDVRMARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDR
VAVQPSSLEMSAL
NT seq 3462 nt NT seq  +upstreamnt  +downstreamnt
atggcctgtccttggaaatttctgttcaagaccaaattccaccagtatgcaatgaatggg
gaaaaagacatcaacaacaatgtggagaaagccccctgtgccacctccagtccagtgaca
caggatgaccttcagtatcacaacctcagcaagcagcagaatgagtccccgcagcccctc
gtggagacgggaaagaagtctccagaatctctggtcaagctggatgcaaccccattgtcc
tccccacggcatgtgaggatcaaaaactggggcagcgggatgactttccaagacacactt
caccataaggccaaagggattttaacttgcaggtccaaatcttgcctggggtccattatg
actcccaaaagtttgaccagaggacccagggacaagcctacccctccagatgagcttcta
cctcaagctatcgaatttgtcaaccaatattacggctccttcaaagaggcaaaaatagag
gaacatctggccagggtggaagcggtaacaaaggagatagaaacaacaggaacctaccaa
ctgacgggagatgagctcatcttcgccaccaagcaggcctggcgcaatgccccacgctgc
attgggaggatccagtggtccaacctgcaggtcttcgatgcccgcagctgttccactgcc
cgggaaatgtttgaacacatctgcagacacgtgcgttactccaccaacaatggcaacatc
aggtcggccatcaccgtgttcccccagcggagtgatggcaagcacgacttccgggtgtgg
aatgctcagctcatccgctatgctggctaccagatgccagatggcagcatcagaggggac
cctgccaacgtggaattcactcagctgtgcatcgacctgggctggaagcccaagtacggc
cgcttcgatgtggtccccctggtcctgcaggccaatggccgtgaccctgagctcttcgaa
atcccacctgaccttgtgcttgaggtggccatggaacatcccaaatacgagtggtttcgg
gaactggagctaaagtggtacgccctgcctgcagtggccaacatgctgcttgaggtgggc
ggcctggagttcccagggtgccccttcaatggctggtacatgggcacagagatcggagtc
cgggacttctgtgacgtccagcgctacaacatcctggaggaagtgggcaggagaatgggc
ctggaaacgcacaagctggcctcgctctggaaagaccaggctgtcgttgagatcaacatt
gctgtgctccatagtttccagaagcagaatgtgaccatcatggaccaccactcggctgca
gaatccttcatgaagtacatgcagaatgaataccggtcccgtgggggctgcccggcagac
tggatttggctggtccctcccatgtctgggagcatcacccccgtgtttcaccaggagatg
ctgaactacgtcctgtcccctttctactactatcaggtagaggcctggaaaacccatgtc
tggcaggacgagaagcggagacccaagagaagagagattccattgaaagtcttggtcaaa
gctgtgctctttgcctgtatgctgatgcgcaagacaatggcgtcccgagtcagagtcacc
atcctctttgcgacagagacaggaaaatcagaggcgctggcctgggacctgggggcctta
ttcagctgtgccttcaaccccaaggttgtctgcatggataagtacaggctgagctgcctg
gaggaggaacggctgctgttggtggtgaccagtacgtttggcaatggagactgccctggc
aatggagagaaactgaagaaatcgctcttcatgctgaaagagctcaacaacaaattcagg
tacgctgtgtttggcctcggctccagcatgtaccctcggttctgcgcctttgctcatgac
attgatcagaagctgtcccacctgggggcctctcagctcaccccgatgggagaaggggat
gagctcagtgggcaggaggacgccttccgcagctgggccgtgcaaaccttcaaggcagcc
tgtgagacgtttgatgtccgaggcaaacagcacattcagatccccaagctctacacctcc
aatgtgacctgggacccgcaccactacaggctcgtgcaggactcacagcctttggacctc
agcaaagccctcagcagcatgcatgccaagaacgtgttcaccatgaggctcaaatctcgg
cagaatctacaaagtccgacatccagccgtgccaccatcctggtggaactctcctgtgag
gatggccaaggcctgaactacctgccgggggagcaccttggggtttgcccaggcaaccag
ccggccctggtccaaggtatcctggagcgagtggtggatggccccacaccccaccagaca
gtgcgcctggaggccctggatgagagtggcagctactgggtcagtgacaagaggctgccc
ccctgctcactcagccaggccctcacctacttcctggacatcaccacacccccaacccag
ctgctgctccaaaagctggcccaggtggccacagaagagcctgagagacagaggctggag
gccctgtgccagccctcagagtacagcaagtggaagttcaccaacagccccacattcctg
gaggtgctagaggagttcccgtccctgcgggtgtctgctggcttcctgctttcccagctc
cccattctgaagcccaggttctactccatcagctcctcccgggatcacacgcccacagag
atccacctgactgtggccgtggtcacctaccacacccgagatggccagggtcccctgcac
cacggcgtctgcagcacatggctcaacagcctgaagccccaagacccagtgccctgcttt
gtgcggaatgccagcggcttccacctccccgaggatccctcccatccttgcatcctcatc
gggcctggcacaggcatcgcgcccttccgcagtttctggcagcaacggctccatgactcc
cagcacaagggagtgcggggaggccgcatgaccttggtgtttgggtgccgccgcccagat
gaggaccacatctaccaggaggagatgctggagatggcccagaagggggtgctgcatgcg
gtgcacacagcctattcccgcctgcctggcaagcccaaggtctatgttcaggacatcctg
cggcagcagctggccagcgaggtgctccgtgtgctccacaaggagccaggccacctctat
gtttgcggggatgtgcgcatggcccgggacgtggcccacaccctgaagcagctggtggct
gccaagctgaaattgaatgaggagcaggtcgaggactatttctttcagctcaagagccag
aagcgctatcacgaagatatctttggtgctgtatttccttacgaggcgaagaaggacagg
gtggcggtgcagcccagcagcctggagatgtcagcgctctga

DBGET integrated database retrieval system