KEGG   Homo sapiens (human): 4851Help
Entry
4851              CDS       T01001                                 

Gene name
NOTCH1, AOS5, AOVD1, TAN1, hN1
Definition
(RefSeq) notch 1
  KO
K02599  
Notch
Organism
hsa  Homo sapiens (human)
Pathway
Endocrine resistance
Dorso-ventral axis formation
Notch signaling pathway
Thyroid hormone signaling pathway
Prion diseases
MicroRNAs in cancer
Module
Notch signaling
Disease
H00002  
Acute lymphoblastic leukemia (ALL) (precursor T lymphoblastic leukemia/lymphoma)
H00554  
Bicuspid aortic valve
H01413  
Adams-Oliver syndrome (AOS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    4851 (NOTCH1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    4851 (NOTCH1)
  Development
   04320 Dorso-ventral axis formation
    4851 (NOTCH1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    4851 (NOTCH1)
  Neurodegenerative diseases
   05020 Prion diseases
    4851 (NOTCH1)
  Antineoplastic resistance
   01522 Endocrine resistance
    4851 (NOTCH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
9q34.3
AA seq 2555 aa AA seqDB search
MPPLLAPLLCLALLPALAARGPRCSQPGETCLNGGKCEAANGTEACVCGGAFVGPRCQDP
NPCLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLL
TLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVN
ECGQKPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDVT
HECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQ
LMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCE
CPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGA
NPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMP
GYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNG
AKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGSCKDGVATFTCLCRPGYTGHHC
ETNINECSSQPCRHGGTCQDRDNAYLCFCLKGTTGPNCEINLDDCASSPCDSGTCLDKID
GYECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGINGFTCRCPEGYHDPTCLSEVNEC
NSNPCVHGACRDSLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCR
EGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRN
GGECRQSEDYESFSCVCPTGWQGQTCEVDINECVLSPCRHGASCQNTHGGYRCHCQAGYS
GRNCETDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFRGTFCEEDINECASDPCRNGANC
TDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQH
DVNECDSQPCLHGGTCQDGCGSYRCTCPQGYTGPNCQNLVHWCDSSPCKNGGKCWQTHTQ
YRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGGLCVDAGNTHHCRCQAGYTGS
YCEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVNCSEEIDECLSHPCQNGGTCLD
LPNTYKCSCPRGTQGVHCEINVDDCNPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFV
GERCEGDVNECLSNPCDARGTQNCVQRVNDFHCECRAGHTGRRCESVINGCKGKPCKNGG
TCAVASNTARGFICKCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGPFTG
PECQFPASSPCLGGNPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHILDYSFGGGAGRDI
PPPLIEEACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYF
SDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLD
CAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYY
GREEELRKHPIKRAAEGWAAPDALLGQVKASLLPGGSEGGRRRRELDPMDVRGSIVYLEI
DNRQCVQASSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPPPPAQLHFMYVA
AAAFVLLFFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNA
SDGALMDDNQNEWGDEDLETKKFRFEEPVVLPDLDDQTDHRQWTQQHLDAADLRMSAMAP
TPPQGEVDADCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASL
HNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQIL
IRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNN
VDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDI
AQERMHHDIVRLLDEYNLVRSPQLHGAPLGGTPTLSPPLCSPNGYLGSLKPGVQGKKVRK
PSSKGLACGSKEAKDLKARRKKSQDGKGCLLDSSGMLSPVDSLESPHGYLSDVASPPLLP
SPFQQSPSVPLNHLPGMPDTHLGIGHLNVAAKPEMAALGGGGRLAFETGPPRLSHLPVAS
GTSTVLGSSSGGALNFTVGGSTSLNGQCEWLSRLQSGMVPNQYNPLRGSVAPGPLSTQAP
SLQHGMVGPLHSSLAASALSQMMSYQGLPSTRLATQPHLVQTQQVQPQNLQMQQQNLQPA
NIQQQQSLQPPPPPPQPHLGVSSAASGHLGRSFLSGEPSQADVQPLGPSSLAVHTILPQE
SPALPTSLPSSLVPPVTAAQFLTPPSQHSYSSPVDNTPSHQLQVPEHPFLTPSPESPDQW
SSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK
NT seq 7668 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgctcctggcgcccctgctctgcctggcgctgctgcccgcgctcgccgcacga
ggcccgcgatgctcccagcccggtgagacctgcctgaatggcgggaagtgtgaagcggcc
aatggcacggaggcctgcgtctgtggcggggccttcgtgggcccgcgatgccaggacccc
aacccgtgcctcagcaccccctgcaagaacgccgggacatgccacgtggtggaccgcaga
ggcgtggcagactatgcctgcagctgtgccctgggcttctctgggcccctctgcctgaca
cccctggacaatgcctgcctcaccaacccctgccgcaacgggggcacctgcgacctgctc
acgctgacggagtacaagtgccgctgcccgcccggctggtcagggaaatcgtgccagcag
gctgacccgtgcgcctccaacccctgcgccaacggtggccagtgcctgcccttcgaggcc
tcctacatctgccactgcccacccagcttccatggccccacctgccggcaggatgtcaac
gagtgtggccagaagcccgggctttgccgccacggaggcacctgccacaacgaggtcggc
tcctaccgctgcgtctgccgcgccacccacactggccccaactgcgagcggccctacgtg
ccctgcagcccctcgccctgccagaacgggggcacctgccgccccacgggcgacgtcacc
cacgagtgtgcctgcctgccaggcttcaccggccagaactgtgaggaaaatatcgacgat
tgtccaggaaacaactgcaagaacgggggtgcctgtgtggacggcgtgaacacctacaac
tgccgctgcccgccagagtggacaggtcagtactgtaccgaggatgtggacgagtgccag
ctgatgccaaatgcctgccagaacggcgggacctgccacaacacccacggtggctacaac
tgcgtgtgtgtcaacggctggactggtgaggactgcagcgagaacattgatgactgtgcc
agcgccgcctgcttccacggcgccacctgccatgaccgtgtggcctccttctactgcgag
tgtccccatggccgcacaggtctgctgtgccacctcaacgacgcatgcatcagcaacccc
tgtaacgagggctccaactgcgacaccaaccctgtcaatggcaaggccatctgcacctgc
ccctcggggtacacgggcccggcctgcagccaggacgtggatgagtgctcgctgggtgcc
aacccctgcgagcatgcgggcaagtgcatcaacacgctgggctccttcgagtgccagtgt
ctgcagggctacacgggcccccgatgcgagatcgacgtcaacgagtgcgtctcgaacccg
tgccagaacgacgccacctgcctggaccagattggggagttccagtgcatctgcatgccc
ggctacgagggtgtgcactgcgaggtcaacacagacgagtgtgccagcagcccctgcctg
cacaatggccgctgcctggacaagatcaatgagttccagtgcgagtgccccacgggcttc
actgggcatctgtgccagtacgatgtggacgagtgtgccagcaccccctgcaagaatggt
gccaagtgcctggacggacccaacacttacacctgtgtgtgcacggaagggtacacgggg
acgcactgcgaggtggacatcgatgagtgcgaccccgacccctgccactacggctcctgc
aaggacggcgtcgccaccttcacctgcctctgccgcccaggctacacgggccaccactgc
gagaccaacatcaacgagtgctccagccagccctgccgccacgggggcacctgccaggac
cgcgacaacgcctacctctgcttctgcctgaaggggaccacaggacccaactgcgagatc
aacctggatgactgtgccagcagcccctgcgactcgggcacctgtctggacaagatcgat
ggctacgagtgtgcctgtgagccgggctacacagggagcatgtgtaacatcaacatcgat
gagtgtgcgggcaacccctgccacaacgggggcacctgcgaggacggcatcaatggcttc
acctgccgctgccccgagggctaccacgaccccacctgcctgtctgaggtcaatgagtgc
aacagcaacccctgcgtccacggggcctgccgggacagcctcaacgggtacaagtgcgac
tgtgaccctgggtggagtgggaccaactgtgacatcaacaacaatgagtgtgaatccaac
ccttgtgtcaacggcggcacctgcaaagacatgaccagtggctacgtgtgcacctgccgg
gagggcttcagcggtcccaactgccagaccaacatcaacgagtgtgcgtccaacccatgt
ctgaaccagggcacgtgtattgacgacgttgccgggtacaagtgcaactgcctgctgccc
tacacaggtgccacgtgtgaggtggtgctggccccgtgtgcccccagcccctgcagaaac
ggcggggagtgcaggcaatccgaggactatgagagcttctcctgtgtctgccccacgggc
tggcaagggcagacctgtgaggtcgacatcaacgagtgcgttctgagcccgtgccggcac
ggcgcatcctgccagaacacccacggcggctaccgctgccactgccaggccggctacagt
gggcgcaactgcgagaccgacatcgacgactgccggcccaacccgtgtcacaacgggggc
tcctgcacagacggcatcaacacggccttctgcgactgcctgcccggcttccggggcact
ttctgtgaggaggacatcaacgagtgtgccagtgacccctgccgcaacggggccaactgc
acggactgcgtggacagctacacgtgcacctgccccgcaggcttcagcgggatccactgt
gagaacaacacgcctgactgcacagagagctcctgcttcaacggtggcacctgcgtggac
ggcatcaactcgttcacctgcctgtgtccacccggcttcacgggcagctactgccagcac
gatgtcaatgagtgcgactcacagccctgcctgcatggcggcacctgtcaggacggctgc
ggctcctacaggtgcacctgcccccagggctacactggccccaactgccagaaccttgtg
cactggtgtgactcctcgccctgcaagaacggcggcaaatgctggcagacccacacccag
taccgctgcgagtgccccagcggctggaccggcctttactgcgacgtgcccagcgtgtcc
tgtgaggtggctgcgcagcgacaaggtgttgacgttgcccgcctgtgccagcatggaggg
ctctgtgtggacgcgggcaacacgcaccactgccgctgccaggcgggctacacaggcagc
tactgtgaggacctggtggacgagtgctcacccagcccctgccagaacggggccacctgc
acggactacctgggcggctactcctgcaagtgcgtggccggctaccacggggtgaactgc
tctgaggagatcgacgagtgcctctcccacccctgccagaacgggggcacctgcctcgac
ctccccaacacctacaagtgctcctgcccacggggcactcagggtgtgcactgtgagatc
aacgtggacgactgcaatccccccgttgaccccgtgtcccggagccccaagtgctttaac
aacggcacctgcgtggaccaggtgggcggctacagctgcacctgcccgccgggcttcgtg
ggtgagcgctgtgagggggatgtcaacgagtgcctgtccaatccctgcgacgcccgtggc
acccagaactgcgtgcagcgcgtcaatgacttccactgcgagtgccgtgctggtcacacc
gggcgccgctgcgagtccgtcatcaatggctgcaaaggcaagccctgcaagaatgggggc
acctgcgccgtggcctccaacaccgcccgcgggttcatctgcaagtgccctgcgggcttc
gagggcgccacgtgtgagaatgacgctcgtacctgcggcagcctgcgctgcctcaacggc
ggcacatgcatctccggcccgcgcagccccacctgcctgtgcctgggccccttcacgggc
cccgaatgccagttcccggccagcagcccctgcctgggcggcaacccctgctacaaccag
gggacctgtgagcccacatccgagagccccttctaccgttgcctgtgccccgccaaattc
aacgggctcttgtgccacatcctggactacagcttcgggggtggggccgggcgcgacatc
cccccgccgctgatcgaggaggcgtgcgagctgcccgagtgccaggaggacgcgggcaac
aaggtctgcagcctgcagtgcaacaaccacgcgtgcggctgggacggcggtgactgctcc
ctcaacttcaatgacccctggaagaactgcacgcagtctctgcagtgctggaagtacttc
agtgacggccactgtgacagccagtgcaactcagccggctgcctcttcgacggctttgac
tgccagcgtgcggaaggccagtgcaaccccctgtacgaccagtactgcaaggaccacttc
agcgacgggcactgcgaccagggctgcaacagcgcggagtgcgagtgggacgggctggac
tgtgcggagcatgtacccgagaggctggcggccggcacgctggtggtggtggtgctgatg
ccgccggagcagctgcgcaacagctccttccacttcctgcgggagctcagccgcgtgctg
cacaccaacgtggtcttcaagcgtgacgcacacggccagcagatgatcttcccctactac
ggccgcgaggaggagctgcgcaagcaccccatcaagcgtgccgccgagggctgggccgca
cctgacgccctgctgggccaggtgaaggcctcgctgctccctggtggcagcgagggtggg
cggcggcggagggagctggaccccatggacgtccgcggctccatcgtctacctggagatt
gacaaccggcagtgtgtgcaggcctcctcgcagtgcttccagagtgccaccgacgtggcc
gcattcctgggagcgctcgcctcgctgggcagcctcaacatcccctacaagatcgaggcc
gtgcagagtgagaccgtggagccgcccccgccggcgcagctgcacttcatgtacgtggcg
gcggccgcctttgtgcttctgttcttcgtgggctgcggggtgctgctgtcccgcaagcgc
cggcggcagcatggccagctctggttccctgagggcttcaaagtgtctgaggccagcaag
aagaagcggcgggagcccctcggcgaggactccgtgggcctcaagcccctgaagaacgct
tcagacggtgccctcatggacgacaaccagaatgagtggggggacgaggacctggagacc
aagaagttccggttcgaggagcccgtggttctgcctgacctggacgaccagacagaccac
cggcagtggactcagcagcacctggatgccgctgacctgcgcatgtctgccatggccccc
acaccgccccagggtgaggttgacgccgactgcatggacgtcaatgtccgcgggcctgat
ggcttcaccccgctcatgatcgcctcctgcagcgggggcggcctggagacgggcaacagc
gaggaagaggaggacgcgccggccgtcatctccgacttcatctaccagggcgccagcctg
cacaaccagacagaccgcacgggcgagaccgccttgcacctggccgcccgctactcacgc
tctgatgccgccaagcgcctgctggaggccagcgcagatgccaacatccaggacaacatg
ggccgcaccccgctgcatgcggctgtgtctgccgacgcacaaggtgtcttccagatcctg
atccggaaccgagccacagacctggatgcccgcatgcatgatggcacgacgccactgatc
ctggctgcccgcctggccgtggagggcatgctggaggacctcatcaactcacacgccgac
gtcaacgccgtagatgacctgggcaagtccgccctgcactgggccgccgccgtgaacaat
gtggatgccgcagttgtgctcctgaagaacggggctaacaaagatatgcagaacaacagg
gaggagacacccctgtttctggccgcccgggagggcagctacgagaccgccaaggtgctg
ctggaccactttgccaaccgggacatcacggatcatatggaccgcctgccgcgcgacatc
gcacaggagcgcatgcatcacgacatcgtgaggctgctggacgagtacaacctggtgcgc
agcccgcagctgcacggagccccgctggggggcacgcccaccctgtcgcccccgctctgc
tcgcccaacggctacctgggcagcctcaagcccggcgtgcagggcaagaaggtccgcaag
cccagcagcaaaggcctggcctgtggaagcaaggaggccaaggacctcaaggcacggagg
aagaagtcccaggacggcaagggctgcctgctggacagctccggcatgctctcgcccgtg
gactccctggagtcaccccatggctacctgtcagacgtggcctcgccgccactgctgccc
tccccgttccagcagtctccgtccgtgcccctcaaccacctgcctgggatgcccgacacc
cacctgggcatcgggcacctgaacgtggcggccaagcccgagatggcggcgctgggtggg
ggcggccggctggcctttgagactggcccacctcgtctctcccacctgcctgtggcctct
ggcaccagcaccgtcctgggctccagcagcggaggggccctgaatttcactgtgggcggg
tccaccagtttgaatggtcaatgcgagtggctgtcccggctgcagagcggcatggtgccg
aaccaatacaaccctctgcgggggagtgtggcaccaggccccctgagcacacaggccccc
tccctgcagcatggcatggtaggcccgctgcacagtagccttgctgccagcgccctgtcc
cagatgatgagctaccagggcctgcccagcacccggctggccacccagcctcacctggtg
cagacccagcaggtgcagccacaaaacttacagatgcagcagcagaacctgcagccagca
aacatccagcagcagcaaagcctgcagccgccaccaccaccaccacagccgcaccttggc
gtgagctcagcagccagcggccacctgggccggagcttcctgagtggagagccgagccag
gcagacgtgcagccactgggccccagcagcctggcggtgcacactattctgccccaggag
agccccgccctgcccacgtcgctgccatcctcgctggtcccacccgtgaccgcagcccag
ttcctgacgcccccctcgcagcacagctactcctcgcctgtggacaacacccccagccac
cagctacaggtgcctgagcaccccttcctcaccccgtcccctgagtcccctgaccagtgg
tccagctcgtccccgcattccaacgtctccgactggtccgagggcgtctccagccctccc
accagcatgcagtcccagatcgcccgcattccggaggccttcaagtaa

DBGET integrated database retrieval system