KEGG   Homo sapiens (human): 51564Help
Entry
51564             CDS       T01001                                 

Gene name
HDAC7, HD7, HD7A, HDAC7A
Definition
(RefSeq) histone deacetylase 7
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05165  Human papillomavirus infection
hsa05203  Viral carcinogenesis
Drug target
Belinostat: D08870
Entinostat: D09338
Panobinostat (DG01403): D10019 D10319
Quisinostat (DG01407): D10321 D10322
Remetinostat: D10977
Romidepsin: D06637
Tucidinostat: D10993
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    51564 (HDAC7)
  Substance dependence
   05034 Alcoholism
    51564 (HDAC7)
  Infectious diseases
   05165 Human papillomavirus infection
    51564 (HDAC7)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     51564 (HDAC7)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     51564 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 51564
NCBI-ProteinID: NP_001091886
OMIM: 606542
HGNC: 14067
Ensembl: ENSG00000061273
Vega: OTTHUMG00000152968
Pharos: Q8WUI4(Tclin)
UniProt: Q8WUI4
LinkDB All DBs
Structure
PDB: 

Jmol
Position
12q13.11
AA seq 954 aa AA seqDB search
MHSPGADGTQVSPGAHYCSPTGAGCPRPCADTPGPQPQPMDLRVGQRPPVEPPPEPTLLA
LQRPQRLHHHLFLAGLQQQRSVEPMRLSMDTPMPELQVGPQEQELRQLLHKDKSKRSAVA
SSVVKQKLAEVILKKQQAALERTVHPNSPGIPYRTLEPLETEGATRSMLSSFLPPVPSLP
SDPPEHFPLRKTVSEPNLKLRYKPKKSLERRKNPLLRKESAPPSLRRRPAETLGDSSPSS
SSTPASGCSSPNDSEHGPNPILGSEADSDRRTHPTLGPRGPILGSPHTPLFLPHGLEPEA
GGTLPSRLQPILLLDPSGSHAPLLTVPGLGPLPFHFAQSLMTTERLSGSGLHWPLSRTRS
EPLPPSATAPPPPGPMQPRLEQLKTHVQVIKRSAKPSEKPRLRQIPSAEDLETDGGGPGQ
VVDDGLEHRELGHGQPEARGPAPLQQHPQVLLWEQQRLAGRLPRGSTGDTVLLPLAQGGH
RPLSRAQSSPAAPASLSAPEPASQARVLSSSETPARTLPFTTGLIYDSVMLKHQCSCGDN
SRHPEHAGRIQSIWSRLQERGLRSQCECLRGRKASLEELQSVHSERHVLLYGTNPLSRLK
LDNGKLAGLLAQRMFVMLPCGGVGVDTDTIWNELHSSNAARWAAGSVTDLAFKVASRELK
NGFAVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQQSKASKILIVDWDVHHGNGTQQTF
YQDPSVLYISLHRHDDGNFFPGSGAVDEVGAGSGEGFNVNVAWAGGLDPPMGDPEYLAAF
RIVVMPIAREFSPDLVLVSAGFDAAEGHPAPLGGYHVSAKCFGYMTQQLMNLAGGAVVLA
LEGGHDLTAICDASEACVAALLGNRVDPLSEEGWKQKPNLNAIRSLEAVIRVHSKYWGCM
QRLASCPDSWVPRVPGADKEEVEAVTALASLSVGILAEDRPSEQLVEEEEPMNL
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgcacagccccggcgctgatgggacccaggtgagcccgggtgcccactactgcagcccc
actggcgcaggctgccccaggccctgtgcagacacaccaggccctcagccgcagcccatg
gacctgcgggtgggccagcggcccccagtggagcccccaccagagcccacattgctggcc
ctgcagcgtccccagcgcctgcaccaccacctcttcctagcaggcctgcagcagcagcgc
tcggtggagcccatgaggctctccatggacacgccgatgcccgagttgcaggtgggaccc
caggaacaagagctgcggcagcttctccacaaggacaagagcaagcgaagtgctgtagcc
agcagcgtggtcaagcagaagctagcggaggtgattctgaaaaaacagcaggcggcccta
gaaagaacagtccatcccaacagccccggcattccctacagaaccctggagcccctggag
acggaaggagccacccgctccatgctcagcagctttttgcctcctgttcccagcctgccc
agtgaccccccagagcacttccctctgcgcaagacagtctctgagcccaacctgaagctg
cgctataagcccaagaagtccctggagcggaggaagaatccactgctccgaaaggagagt
gcgccccccagcctccggcggcggcccgcagagaccctcggagactcctccccaagtagt
agcagcacgcccgcatcagggtgcagctcccccaatgacagcgagcacggccccaatccc
atcctgggctcggaggctgacagtgaccgcaggacccatccgactctgggccctcggggg
ccaatcctggggagcccccacactcccctcttcctgccccatggcttggagcccgaggct
gggggcaccttgccctctcgcctgcagcccattctcctcctggacccctcaggctctcat
gccccgctgctgactgtgcccgggcttgggcccttgcccttccactttgcccagtcctta
atgaccaccgagcggctctctgggtcaggcctccactggccactgagccggactcgctca
gagcccctgccccccagtgccaccgctcccccaccgccgggccccatgcagccccgcctg
gagcagctcaaaactcacgtccaggtgatcaagaggtcagccaagccgagtgagaagccc
cggctgcggcagataccctcggctgaagacctggagacagatggcgggggaccgggccag
gtggtggacgatggcctggagcacagggagctgggccatgggcagcctgaggccagaggc
cccgctcctctccagcagcaccctcaggtgttgctctgggaacagcagcgactggctggg
cggctcccccggggcagcaccggggacactgtgctgcttcctctggcccagggtgggcac
cggcctctgtcccgggctcagtcttccccagccgcacctgcctcactgtcagccccagag
cctgccagccaggcccgagtcctctccagctcagagacccctgccaggaccctgcccttc
accacagggctgatctatgactcggtcatgctgaagcaccagtgctcctgcggtgacaac
agcaggcacccggagcacgccggccgcatccagagcatctggtcccggctgcaggagcgg
gggctccggagccagtgtgagtgtctccgaggccggaaggcctccctggaagagctgcag
tcggtccactctgagcggcacgtgctcctctacggcaccaacccgctcagccgcctcaaa
ctggacaacgggaagctggcagggctcctggcacagcggatgtttgtgatgctgccctgt
ggtggggttggggtggacactgacaccatctggaatgagcttcattcctccaatgcagcc
cgctgggccgctggcagtgtcactgacctcgccttcaaagtggcttctcgtgagctaaag
aatggtttcgctgtggtgcggcccccaggacaccatgcagatcattcaacagccatgggc
ttctgcttcttcaactcagtggccatcgcctgccggcagctgcaacagcagagcaaggcc
agcaagatcctcattgtagactgggacgtgcaccatggcaacggcacccagcaaaccttc
taccaagaccccagtgtgctctacatctccctgcatcgccatgacgacggcaacttcttc
ccggggagtggggctgtggatgaggtaggggctggcagcggtgagggcttcaatgtcaat
gtggcctgggctggaggtctggacccccccatgggggatcctgagtacctggctgctttc
aggatagtcgtgatgcccatcgcccgagagttctctccagacctagtcctggtgtctgct
ggatttgatgctgctgagggtcacccggccccactgggtggctaccatgtttctgccaaa
tgttttggatacatgacgcagcaactgatgaacctggcaggaggcgcagtggtgctggcc
ttggagggtggccatgacctcacagccatctgtgacgcctctgaggcctgtgtggctgct
cttctgggtaacagggtggatcccctttcagaagaaggctggaaacagaaacccaacctc
aatgccatccgctctctggaggccgtgatccgggtgcacagtaaatactggggctgcatg
cagcgcctggcctcctgtccagactcctgggtgcctagagtgccaggggctgacaaagaa
gaagtggaggcagtgaccgcactggcgtccctctctgtgggcatcctggctgaagatagg
ccctcggagcagctggtggaggaggaagaacctatgaatctctaa

DBGET integrated database retrieval system