KEGG   Homo sapiens (human): 6392Help
Entry
6392              CDS       T01001                                 

Gene name
SDHD, CBT1, CII-4, CWS3, PGL, PGL1, QPs3, SDH4, cybS
Definition
succinate dehydrogenase complex, subunit D, integral membrane protein
Orthology
K00237  
succinate dehydrogenase (ubiquinone) membrane anchor subunit
Organism
hsa  Homo sapiens (human)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Carbon metabolism
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase (ubiquinone)
Disease
H00034  
Carcinoid
H01222  
Cowden-like syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    6392 (SDHD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    6392 (SDHD)
  Energy metabolism
   00190 Oxidative phosphorylation
    6392 (SDHD)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    6392 (SDHD)
   05012 Parkinson's disease
    6392 (SDHD)
   05016 Huntington's disease
    6392 (SDHD)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    6392 (SDHD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
11q23
AA seq 85 aa AA seqDB search
MAVLWRLSAVCGALGGRALLLRTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHWALD
KLLLTMFMGMPCRKLPRQGFWHFQL
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atggcggttctctggaggctgagtgccgtttgcggtgccctaggaggccgagctctgttg
cttcgaactccagtggtcagacctgctcatatctcagcatttcttcaggaccgacctatc
ccagaatggtgtggagtgcagcacatacacttgtcaccgagccaccattgggccttggac
aagttgttactgactatgttcatggggatgccttgcagaaagctgccaaggcagggcttt
tggcactttcagctttaa

DBGET integrated database retrieval system