KEGG   Herbaspirillum seropedicae SmR1: Hsero_1073Help
Entry
Hsero_1073        CDS       T01268                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hse  Herbaspirillum seropedicae SmR1
Pathway
hse00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Hsero_1073 (gst)
Enzymes [BR:hse01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Hsero_1073 (gst)
Transporters [BR:hse02000]
 Other Transporters
  Pores ion channels [TC:1]
   Hsero_1073 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 GST_N_4 GST_C_6
Motif
Other DBs
NCBI-ProteinID: ADJ62590
UniProt: D8J1G9
LinkDB All DBs
Position
1186452..1187072
Genome map
AA seq 206 aa AA seqDB search
MKIHHHPLSGHAHRAVLFASLLGLPAELVEVDLAAGAHKKPAFLALNPFGQVPVLEDGEV
VIADSNAILVYLAKKAGRSDWLPEDAQGAAAVQRWLSVAAGELAYGPAAARLVTVFGAAF
NAEEVIQRAHLLLGRLEQHLAKRDWLAADHPTIADVAVYSYLARAPEGNVDLRGYPGVQG
FLQRIEALPGFVPFAQTAAGLMAAQA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccatcaccatcctctctcgggccacgcccatcgcgccgtcctgtttgcctcg
ctcctgggccttccggccgagctggtcgaagtcgacctggccgctggcgcccacaagaag
ccggccttcctggccctcaatccgttcggccaggtgccggtgctggaagatggcgaggtg
gtgattgccgactccaacgccatcctggtctatctggccaagaaggctggccgcagcgac
tggctgcccgaagacgcccagggcgcggccgccgtgcagcgctggctgtcggtggccgcc
ggtgagctggcatacggcccggcggcggcgcggctggtgacggtcttcggtgcagccttc
aacgccgaggaagtgatccagcgcgcccacctcttgctggggcgcctggaacagcacctg
gccaagcgagactggcttgccgccgaccacccgaccattgccgacgtagcggtctacagc
tatctcgcccgcgctcccgagggcaatgtcgatctgcgtggctatccgggcgtgcaaggc
ttcttgcagcgcatcgaagccttgcccggcttcgtccccttcgcccagactgcggctggc
ctgatggcagcccaggcctga

DBGET integrated database retrieval system