KEGG   Haemophilus somnus 2336: HSM_0063Help
Entry
HSM_0063          CDS       T00673                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
hsm  Haemophilus somnus 2336
Brite
Translation factors [BR:hsm03012]
 Eukaryotic Type
  Elongation factors
   HSM_0063
 Prokaryotic Type
   HSM_0063
Mitochondrial biogenesis [BR:hsm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    HSM_0063
Exosome [BR:hsm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HSM_0063
  Exosomal proteins of breast cancer cells
   HSM_0063
  Exosomal proteins of colorectal cancer cells
   HSM_0063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(55438..56622)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLSKHFGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTATRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALQALN
GVAEWEEKILELASHLDNYIPEPERAIDQPFLLPIEDVFSISGRGTVVTGRVERGIIRTG
EEVEIVGIKETTKTTVTGVEMFRKLLDEGRAGENIGALLRGTKREEIERGQVLAKPGSIT
PHTDFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMT
VSLIHPIAMDQGLRFAIREGGRTVGAGVVAKIIK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaaatttgaacgtacaaaaccgcacgtaaacgtgggtacaatcggccac
gttgaccacggtaaaacaactttaacagcagcgatcacgactgtattatccaaacacttt
ggtggtgcggcacgtgcatttgaccaaattgataacgcaccggaagagaaagcacgtggt
atcactatcaacacttcacacgttgaatatgatacagcgacacgtcactacgcacacgtt
gactgtccgggacacgctgactatgtaaaaaatatgattacaggtgcggcacaaatggac
ggagctattttagtggtagcggcaacagacggtccaatgccacaaactcgtgagcacatc
ttattaggtcgtcaggtaggtgtaccgtacatcatcgtattcttaaacaaatgcgacatg
gtagatgacgaagaattattggaattggttgagatggaagtacgtgaattactttctcaa
tacgacttcccgggcgatgacacaccaattgtacgtggttcagcattacaagcattaaat
ggagttgctgagtgggaagaaaaaattcttgaattagcgtctcacttagacaactatatt
ccggagcctgagcgtgcgattgaccaaccgttcttattaccgattgaagatgttttctca
atttcaggacgtggtacagtagtaaccggacgtgtagagcgtggtattatccgtactggt
gaagaagttgaaattgtcggtattaaagagacaacaaaaaccacggtaacgggtgtagaa
atgttccgtaaattattagacgaaggtcgtgcgggagaaaacattggagcattattacgt
ggaacaaaacgtgaagaaattgaacgtggtcaagtattagcgaaaccgggttcaattaca
ccgcacacagactttgaatcagaagtttatgtgttgtcaaaagaggaaggaggacgtcat
actccattcttcaaaggttaccgtccacaattctatttccgtactactgacgtaaccggt
acaattgaattaccggaaggtgttgaaatggtcatgcctggcgataacatcaaaatgaca
gtaagcttaattcacccgattgcgatggaccaagggttacgttttgcgattcgtgaaggt
ggacgtactgtaggtgcgggtgttgttgctaagatcattaagtaa

DBGET integrated database retrieval system