KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105182032Help
Entry
105182032         CDS       T03918                                 

Definition
(RefSeq) neuroendocrine convertase 2
  KO
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Brite
Enzymes [BR:hst01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     105182032
Peptidases [BR:hst01002]
 Serine Peptidases
  Family S8: subtilisin family
   105182032
Chaperones and folding catalysts [BR:hst03110]
 Intramolecular chaperones
  Subtilisin family
   105182032
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 843 aa AA seqDB search
MLESRRGYNLPCVASSSAVVAAADKGKSVKEDLPSDPFVIRAVYESTATATATATAIGKL
SDETWSTSGSRPGTSLQENYLLVDEDKCRSPPIIAKIQVRDRSGNDVASVAAMSVNSPDF
GYNSIPKSAFKDYRELYARSNVKKSDTFKIIDGSEGLEEHAEHSDSKINGNYHRVPRVVA
EYLGVSSVRESANAKYGPDALRCRPPLVTMLLAVIALLSLAAGTTTAEIFTNTFLVRMRQ
PAERHVADRVALRNGFVNLGPVLDSQTEYHFVHRALPHVRSKRSVPHMRRLKVDPLVDTA
IQQAGFKRVKRGYKPLSVDNLVPLYEMKNPGNPGNKDPTDPFFKYQWYLKNIGQNGGKPK
LDLNVEAAWAQGVTGKNVTTAIMDDGVDYMHPDLKYNYNAKASYDFSSNDPYPYPRYTDD
WFNSHGTRCAGEVAAARDNGVCGVGVAYDSKIAGIRMLDQPYMTDLIEANSMGHEPDLID
IYSASWGPTDDGKTVDGPRNATMRAIVRGVNEGRKGLGNIYVWASGDGGEEDDCNCDGYA
ASMWTISINSAINDGQNAHYDESCSSTLASTFSNGAKDPNTGVATTDLYGKCTTTHSGTS
AAAPEAAGVFALALEANPQLTWRDIQHLTVLTSKRNSLFDAKDRFHWTMNGVGLEFNHLF
GYGVLDAGAMVALAKKWKTVPPRYHCEAGSMFDTQEVTSDRSILVKIKTDACAGTEYAVN
YLEHVQAVISVNATRRGDLELFLTSPMGTRSMILSRRVNDDDHRDGFTKWPFMTTHTWGE
YPQGTWLLEVSFNTQTPQHGWLREWTLMLHGTKEPPYTGLSAADPHSKLAIVKKAHEERL
SAI
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atgttagaatctaggaggggatataatttaccgtgcgtcgccagcagcagcgcggtcgtt
gccgccgctgacaagggcaagagtgtgaaggaggatcttccctcagatcccttcgtcatc
cgcgccgtctacgagtcgactgccaccgccaccgccaccgccaccgccatcggcaaactt
tccgatgagacctggtcgacgagcggcagcagacctggcaccagcttgcaagagaactac
ttgctcgtcgacgaggacaagtgccgttcgccgccgatcatcgccaagatccaagtgaga
gatcgaagtggcaacgacgtcgccagcgtcgccgcgatgagcgtcaattcaccggacttc
ggctacaactcgatcccgaagagcgccttcaaggattatcgggaactgtacgctcgctcc
aacgtgaagaagagcgacaccttcaagatcatcgacggaagcgagggcctggaagaacac
gccgagcattccgactcgaagataaatggcaactaccatcgcgtacctcgagtagtcgcc
gagtacctcggagtgtccagtgtccgcgaatccgcgaatgcgaagtacggtccggacgcg
cttcgttgccggccgcccctcgtcacgatgctactcgcggtgatcgcgctactctccctc
gccgccggtacgaccaccgctgagatcttcaccaacacgttcctggtgaggatgcggcaa
ccagcggagaggcacgtagccgaccgcgtagcgctcagaaacggattcgtcaatcttggg
ccggttctagacagccagacggagtatcacttcgtacacagagctttgccgcacgtgcga
agtaaaagatccgtgccacacatgcgaaggttgaaggtcgatcctttggtggatacggcc
atacagcaggctggcttcaagagggtcaagaggggctacaagcccctgagcgtagacaac
ctcgtacccttgtacgaaatgaaaaatccggggaatcccgggaacaaagacccgaccgat
cccttcttcaagtaccagtggtacctgaagaatatcgggcaaaatggcggcaagccgaag
ctggatctaaacgtcgaggccgcctgggctcagggtgtcacgggaaagaacgtaacgacg
gctattatggatgacggtgtcgactacatgcatcccgatctcaagtacaactataacgct
aaagcctcctacgacttcagcagtaacgatccatatccttatcctagatacactgacgac
tggttcaacagccacggtacaagatgcgccggcgaggtcgcagccgcgcgtgacaacggg
gtgtgcggcgttggggtggcgtacgactcgaagatcgccgggattcggatgctggatcaa
ccttacatgaccgacctgatcgaggccaacagcatgggccacgagcccgacctcatagat
atttacagcgcctcctgggggccgacggacgacgggaagacggtagacgggccgcgaaac
gcaaccatgagggccattgttcgcggcgttaatgagggtagaaagggcttgggtaacatt
tacgtctgggcttccggagacggcggtgaggaggacgattgcaactgcgacggatacgct
gcgagcatgtggaccattagtattaatagcgccattaacgacggacagaacgctcattac
gacgagagttgttccagcaccttagcttctaccttcagcaacggtgctaaggatcccaac
accggagtggctaccacggatctgtatggaaagtgtacgacgactcacagcgggacgtcc
gccgcggcaccggaagccgcaggagtatttgcgcttgctctcgaagctaatccgcagcta
acgtggagagacattcaacacttgaccgtcctaacttcgaagaggaattctctgttcgac
gccaaagacagatttcactggaccatgaacggcgtcggactcgagttcaatcatcttttc
ggatatggcgtcttggacgcgggcgctatggtagcgttggccaagaagtggaaaacggta
ccgccgagataccactgtgaggccggctctatgtttgacacgcaggaagtcacgagcgat
cgatccattctcgtgaagattaagactgacgcgtgtgccggcacggaatatgccgtcaac
tatttggagcacgtacaagccgtcatatccgttaacgcgactcgccgcggtgatctcgag
ttgttccttacatctccgatgggcacgagatctatgatcttaagtcgtagagtaaacgat
gacgatcatagagatggatttacgaaatggccgtttatgacgacacacacgtggggcgaa
tatcctcagggtacctggctgctagaggtaagtttcaacactcagactcctcaacatgga
tggctgagggaatggacgttgatgctgcacggcaccaaagaaccaccgtacacgggattg
tcagcggcggatcctcactccaaattagcgatcgtgaaaaaggcccacgaggagcgattg
agcgcgatctaa

DBGET integrated database retrieval system