KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105183369Help
Entry
105183369         CDS       T03918                                 

Definition
(RefSeq) histone-lysine N-methyltransferase Suv4-20
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:hst00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    105183369
Enzymes [BR:hst01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105183369
Chromosome [BR:hst03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105183369
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 1181 aa AA seqDB search
MVVDCYSIQASATIGRKQERRLGCTVGAKMQTNTGGGGGGMTPKELCDNDDLATSLVLDP
YLGFVTHKMNIRYRPLKANKDELRKIICEFIQNQNYEKAYKKLMGGDWGARLPHTKSKQQ
QINLENHVKRYLRVFDKESGFAIEPCYRYSLEAQKGAKICATRKWLKNEKISCLVGCIAE
LSEKEEAALLHPGKNDFSVMFSCRKNCAQLWLGPAAYINHDCRANCKFVPTGRDTACVKV
LRDIEVGEEITCFYGEDFFGDNNCYCECETCERRGTGAFASQKPGEELSSGYRLRETDNR
INRTKHRQQPLNRNKQQADTALTERNAVLVGNVAVAPQSLSMKELRRKGLTKYDAELLIA
QGCRFSDINQQQQPAINNGENVLQTRPHPSALTSTSVTRNLRNKQMGKFDGSTADGSAIK
TTQPLRAPRLHKRTESKKGKLTVKSRSPCLSNSVIKDTEVADIGHRKEDSDRVPVHEESL
YSRLQKQIHSLNAEMEHGFCVEEPRRTVVTESSSEGSSFQRECPLRLTEVSENTSESNGD
SVEEERAIPDLIAEVDALKPVDNVNSSNYKKGHYSTNACDSIRLSSTSQVHVQCLHTAEL
LPEEGTSCQSRDSRASSPVRDNESENDLRGSTERASCVSKRSKSHSRQFVSSDEQESRKM
LPSEESSCVFQDEDTSPSIGERASPPQVDFRESDARVVETSRSDDEGCDETSPAKVIVMQ
KYTVGRQVESENCGSAIVAVDNANPAARSDSVEFSGLNPEGIDIETAAPTGNVFKCRDSS
MLPSQEGQTCFLTRSDDAYVGGGVETCDIVVKPDATALRSADDVDVRLNFSEGSGAPADF
GSMQAANYNDLTGHTSLDENVREFSSKRSSSKRKDASDGSSRSRKSQKRLSSGKSKSKHS
VLLDDAGQHAASDGVSVKSHSKASKSKNRSTRSQRRDRQRSATAEIGEADDDSGIQGDIY
EFSEKESNLEDIGILSIIRRGGKHETRHHASSISSHLQEMQCNEDYSKTEPPVLVPEEPW
PPATDPSRSEHHATDTNNGVQSGANCDVETSLDRLAAYDENSRARKSSTPSECQWRTSSS
DCRVCPVTPERTGGRLKLTLRMKRSPVLDDIAESGTSLSEDSYEPEYEVLRVEGVERSKR
RKKHKSRSHERGHKKRDYPPPMKRLRLILGNETHTIDLPHS
NT seq 3546 nt NT seq  +upstreamnt  +downstreamnt
atggtggtggattgctattcgattcaggcttcagcaactataggaagaaagcaggagcga
aggttaggttgcacagtgggtgcaaagatgcaaacgaataccggtggtggaggaggtgga
atgacacctaaagagctttgcgataatgatgacctggccacgtctcttgtgttagatccc
tacttaggattcgtcacacataaaatgaatattagatatagaccattgaaggcaaacaag
gatgaactccggaaaattatctgtgaattcatccagaatcaaaattatgaaaaggcttac
aagaaattgatgggtggggactggggtgcacggcttcctcatacaaaatccaaacagcag
caaatcaatctggaaaaccatgttaagagatacttgcgagtttttgacaaggaatctgga
ttcgcaatagagccatgctacagatacagtttagaggcacaaaagggtgccaaaatatgt
gccactcgcaagtggctgaaaaacgagaagatttcttgcctcgtcggttgcatagcagag
cttagtgaaaaggaggaagccgcattgctacaccctggcaagaacgacttttccgtaatg
ttcagctgccggaaaaactgcgcccaattatggctgggacctgctgcctacataaaccac
gactgcagagcaaactgcaagttcgtgccgacgggaagggacacggcttgcgtcaaagtg
ttgcgcgatattgaggtgggcgaggagatcacttgcttctatggagaggatttctttggc
gacaataactgctactgcgaatgcgagacatgtgagaggcgaggtaccggcgcgttcgcg
agtcagaagccgggcgaggaactgtcgtcaggttaccgcttgagggaaactgataaccga
atcaaccggacgaaacatcggcagcaaccgttgaacagaaacaagcagcaggccgatacc
gctctcaccgagcggaacgcagttttggtcgggaacgtggcggtcgcaccgcagtctctc
agtatgaaggagctgcggcgcaaaggactcaccaagtacgacgccgagttgctgatcgcg
caaggctgtcgcttctcggacatcaatcagcagcagcagccagccatcaacaacggcgag
aatgtgctacagaccagacctcacccctccgctttgaccagcacttccgttacaaggaac
ctccggaataagcagatgggcaagtttgatggcagcaccgctgacgggagcgccattaaa
actactcagccgcttagagcgcctaggcttcacaagagaacggaatcgaaaaagggcaag
ctcaccgtaaaatcccggtccccgtgtctcagcaattcggtaatcaaggatacggaagtg
gcagacatcggtcatcgtaaggaggactccgacagagtgccggtgcacgaggagagtctg
tactcgcgattacagaagcagatccactcgttgaacgcggagatggagcacggtttctgc
gtggaggagccgcggcgcaccgtcgtgacggaatcctcgagcgagggttcgtccttccaa
cgagagtgtccgttgcgactgacggaggtgtcggagaacaccagcgagtccaacggcgac
tcggttgaggaagagcgggcgataccggacctcatcgcggaagtcgacgctcttaagcca
gtagataacgttaattcttccaattacaaaaagggacattatagtacaaacgcctgtgat
tcaatccgacttagttccacgtctcaagtccacgtacaatgcttacacactgcagaactg
ttacccgaggagggcacatcgtgccaatcgagggacagtcgcgcttcgtcgcccgtgcgg
gataacgagagcgagaacgatttacgcggctcgaccgagcgagcgagttgcgtgagcaaa
cgttccaagtctcacagcaggcagttcgtctcgtcggacgagcaagagagtcgcaagatg
ctaccgagcgaggaatcgtcttgcgtattccaagacgaggacacctcaccgtcgatcggc
gagagagcttcgcccccccaggtggactttcgcgagagcgacgcgcgagtggtcgagacg
agtcgatcggacgatgaaggctgcgacgagacgagccccgccaaggtaatcgtgatgcag
aagtacactgtgggccgacaagtggagagtgagaactgcgggagcgcgatcgtcgcagtg
gacaacgcgaatccggcggctcgctcggacagtgtcgagtttagtggactgaaccccgag
ggaatagacatagagacagcagcgccgaccgggaacgttttcaagtgccgtgatagttcg
atgctgcccagccaagaagggcaaacctgcttcttgacgagaagcgacgacgcgtacgtt
ggcggcggcgtggagacatgtgacatcgtggtcaagcccgacgcgacggcgttacgttct
gctgacgacgtcgacgtcaggctgaatttcagcgaaggcagtggcgcaccggcggacttc
gggagcatgcaagctgcgaactacaacgacttgaccggtcacacgagtttggacgagaac
gttcgcgagttcagctcgaagaggtcgtcgtccaaacggaaagacgcgtcggacggctcc
tcgagatctcgcaaatcgcagaagagactctcgagcggcaagtccaagtccaagcacagc
gtgttgttggacgatgctggtcagcacgcagcaagcgacggtgtgagcgtcaagagtcac
agcaaggcgagcaagagcaagaaccgatcgaccagaagccagaggagggatcgccagagg
tcggcgaccgctgagatcggggaggccgacgacgactcaggtatccagggcgacatctac
gagttcagcgagaaggagagcaacctggaggacatcggtatactgtccatcataagacgc
ggcggcaagcacgagactcgtcatcatgcctcctcgatctcgtcgcatctgcaggagatg
cagtgcaacgaggactatagcaagaccgagccgccggtgctcgtcccggaggagccgtgg
ccgccggccacggatccgagtcgaagcgagcaccacgccacggacaccaataacggtgtt
cagtcgggagcgaactgcgacgtcgaaacgagcctggacagactggcagcctacgacgag
aacagcagagcgcgcaaatcctcgaccccatccgagtgccaatggcgaacgagcagttcc
gactgccgggtttgtcccgtcacgccagagagaaccggtgggcggctaaagctaacgttg
cgcatgaagcggtcgccggtgctggacgatatcgccgagtccggcaccagcctgagcgaa
gacagctatgagccggagtacgaagtattgcgcgtcgagggggtggaaaggagtaaacgc
cggaaaaagcataaaagcagaagccacgagagggggcataagaaacgcgactacccgccg
cccatgaagaggttacgcctgatcttgggaaacgagacacacaccatcgacttgccgcac
tcttaa

DBGET integrated database retrieval system