KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105188756Help
Entry
105188756         CDS       T03918                                 

Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Brite
Enzymes [BR:hst01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     105188756
Peptidases [BR:hst01002]
 Metallo Peptidases
  Family M2
   105188756
Exosome [BR:hst04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105188756
CD molecules [BR:hst04090]
 Proteins
  105188756
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 646 aa AA seqDB search
MLRLLLTVAVVALVITATPTSKEPTEASPVATNPTEDSQSTDVLKNAKSVLKRLDAELGK
WYNKQSIAEWNYASNLTKENLAEKLNMSVMVTTALKHISQEANNFPWEDLKDEDIKRQFK
KLSVVGNAMLSEEVQKEFDETISTMQNIFSTAKICDYVNRTKCDIALEPEITEIFMRSRD
PKELEYIWVEWRKASGEKVKSLYIKYVEMANNIARLYNYPDYAAYWMRDYETDNFPEQIE
TLWQQLKPLYLQLHAYVRRELREKYGEDLVSKDGPIPAHLLGNVWAQSWSNIADFTIPFP
GKQLPDVSSSLVKQGYNATSIFRLAEDFFKSINLTAMPDSFWEKSILTKIEDVDMICHAS
AWDFYDGKDFRIKQCTRINMEDMFTAHHEMGHVEYFLQYKDQPTIYKQGANPGFHEAVGD
VIALSVSTPSHLKNIGLLQDDSTDPEAMLNNLYVKSLEKIVFLPFSYMLDRWRWNVFQGK
VTSDNYNCNWWSLAEEYQGIEPPVDRSEEDFDPGAKYHVVADVEYIRYFVSFVIQFQFHK
ALCTEAKQYDPKNPEAHLLHQCDIYNNKDAGNLLKSMLEMGSSKPWPDAMEKITKQRDMD
SAGLLEYFKPLINWLTEENKKTNEYIGWKPSNRKCVQTRGELRVIS
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcctacttttgacagtagcggtcgtagctttggttataacagccactccaacg
agtaaggagcctaccgaagccagtcctgttgcaacaaatcctacggaagattcacagtct
actgacgttttgaaaaatgcgaagtctgtcctaaaacgtctcgacgcggagttagggaaa
tggtacaacaagcaaagcattgcagaatggaattatgcctcaaacttgacgaaggagaac
ttggcggagaagctgaacatgtccgtgatggtgaccaccgctttgaaacacatatctcag
gaagctaataattttccatgggaagatttaaaagacgaggatattaagaggcagtttaag
aaactcagtgtcgtcggcaatgcgatgctttctgaagaggtgcagaaggagtttgatgag
acgatcagcacgatgcagaacatctttagtaccgcgaagatctgcgactacgtaaatcgg
acgaaatgcgatatcgcgcttgagccagagatcactgaaattttcatgcgtagccgtgat
cctaaggagctagagtacatctgggtggagtggaggaaggcgtcgggtgagaaagtgaag
tctctgtacatcaagtatgtcgagatggccaataacatcgcgaggctctacaactatcct
gattatgccgcgtactggatgagagactacgagaccgataatttccccgagcagatcgag
actctatggcaacagttgaagccgctgtacctgcagttgcacgcttatgtgcgacgtgag
ctcagggagaagtacggcgaagaccttgtctccaaggacggaccgatcccggcacatctc
ttgggcaacgtatgggcccagtcttggtcgaatatcgcggacttcaccataccttttccg
ggcaagcaattaccggatgtgagctcctctctggtgaaacaaggttacaacgcgacgagc
atctttcgcctcgccgaagacttcttcaagtcgatcaacttgaccgccatgccggactca
ttttgggagaaatcgattttaacgaagatagaggatgtagatatgatctgtcacgcaagc
gcatgggacttttacgacggcaaagactttaggatcaagcaatgtacgcgcatcaacatg
gaggatatgttcacagctcatcatgaaatgggtcacgtcgagtacttcttgcaatacaag
gaccaaccgactatttacaagcagggtgcgaatcctggcttccatgaagcagtcggtgat
gttatcgctcttagtgtatccactcccagtcatctcaagaacattggtctactccaagat
gattcgactgacccagaagcgatgttgaataatctctatgtaaagagtcttgaaaagatc
gtttttctaccgttttcttacatgttggatcgatggcgctggaacgtattccaaggaaag
gttacatctgacaattataactgcaactggtggtctctcgcagaggagtaccaaggcata
gagcctccggtagacaggtctgaggaagatttcgatcccggcgcgaaataccacgtggtc
gcggatgtggaatatatcaggtacttcgtgagcttcgtgatacaattccagtttcacaag
gcgttgtgtaccgaggcgaagcaatacgatccgaagaatccggaggctcatctgttacat
cagtgtgatatttataacaataaggatgcgggaaatcttctgaagtctatgttggagatg
ggttcttcgaaaccatggccagacgcgatggagaagattacgaagcaacgggatatggac
tcggccggactgttagaatatttcaaaccgttgatcaattggctaacagaagaaaataag
aaaaccaatgaatatatcggatggaaacccagtaatagaaaatgcgtacaaaccagagga
gagcttcgagttatctcgtga

DBGET integrated database retrieval system