KEGG   Herbaspirillum seropedicae Z67: ACP92_14660Help
Entry
ACP92_14660       CDS       T04519                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
hsz  Herbaspirillum seropedicae Z67
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hsz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACP92_14660
  Energy metabolism
   00680 Methane metabolism
    ACP92_14660
Enzymes [BR:hsz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ACP92_14660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3323189..3326101
Genome map
AA seq 970 aa AA seqDB search
MATTNPTKRSARSAPSTSRSAGANPAATSITPSKPARGADKDAPLKEDIRLLGRLLGEVL
REQEGDEVFEVVETIRQTAVRFRRESDAKAGAELDKLLKKLTRDQTNSVVRAFSYFSHLA
NIAEDQHHNRRRRAHLLAGSEAQPGSVAYALSRLDDAGVSGAQVRNFLKEALVSPVLTAH
PTEVQRKSILDAEREIARLVAERDLPLTPRELRHNTELLRARIATLWQTRMLRYTKLTVA
DEIENALSYYRTTFLRELPALYEDIEAEIDSQFPARGKSRPTELPPYVQMGSWIGGDRDG
NPNVNAGTMQHALQRQSTVVFDYYLEEVHTLGAELSISTLMVDASPELLALAATSPDHSE
HRADEPYRRALIGIYARLAATARALGAINILRQEVGAAAPYETPEQCVAELDVLVSSLQA
HHGAALVKPRLAGLKRAVEIFGFHLATLDMRQSSDIHERVLADLFAKAQVEADYAALNEE
RKIALLLGELSRPRLLHSPYLEYSEQTDSELSILRAAREIRRRYGERAIRNYIISHTETL
SDLLEVLLLQKETGLLHIEGNQLRELELMVIPLFETIPDLRCAAEIMRGWLSLPQVKGLI
AKHGKLQEVMLGYSDSNKDGGFLTSNWELYKAENQLVELFNEAGVKLRLFHGRGGTVGRG
GGPSYQAILAQPPGTVNGQIRLTEQGEIIASKFANPEIGRRNLELLVAATLEASLMPTNA
DDKEARKLAEFERVMEELSERAYRAYRNLVYETPGFTDYFFAATPIAEIAQLNIGSRPAS
RKATQRIEDLRAIPWGFSWGQCRLLFPGWYGFGSAVSGWLEDAGNAKEAARRLATLRAMC
KEWPFFAALLSNMDMVLSKTDLAVASRYAGLVADRKLRNAIFGRITDEHERTSAMLSTIT
GSKERLAANPLLARSIKNRFAYLDPLNHLQVELIKRHRATVAAKRTPEERVQRGIHLTIN
GVAAGLRNTG
NT seq 2913 nt NT seq  +upstreamnt  +downstreamnt
atggcgactacaaatccaactaaacgcagtgcccgttcggctccatccacctcccgttcc
gccggcgccaaccccgccgcaaccagcattacccccagcaaacccgcccgcggcgccgac
aaggatgcgccgctcaaggaagacatccgcctgctcggccgcctgctcggcgaggtgctg
cgcgaacaggaaggcgatgaggtcttcgaggtcgtggaaacgatccgccagactgccgtg
cgctttcgccgcgaatccgacgccaaggccggcgccgagctggacaagctgttgaagaag
ctgacccgcgaccagaccaattcggtggtgcgcgccttctcctacttctcgcacctggcc
aacatcgccgaagaccagcaccacaaccgccgccgccgcgcccacctgctggccggttcc
gaggcccagccgggcagcgtggcctatgcgctctcgcgtctggacgacgctggcgtctcg
ggtgcacaggtgcgcaatttcctcaaggaagcgctggtgtcgccggtgctcacggcccac
ccgaccgaggtgcagcgcaagtccatcctggacgccgagcgtgagatcgcccgcctggtg
gccgaacgcgacctgccgctgacgccccgcgagctgcgccacaacaccgaactcttgcgc
gcgcgcatcgctacgctgtggcagacccgcatgctgcgctataccaagctgaccgtggcc
gacgagatcgagaacgccctctcctactaccgcaccaccttcctgcgcgaactgccggcg
ctgtatgaggacatcgaagccgagatcgacagccagttcccggcacgcggcaagagccgt
cccaccgaactgccgccctacgtgcagatgggcagctggatcggcggcgaccgcgacggc
aaccccaatgtcaatgccggcaccatgcagcatgccttgcagcgccagtccacggtggtg
ttcgactactacctggaagaagtgcatacgctgggcgcagagctgtccatctcgaccctg
atggtcgatgccagccccgaattgctggccctggcggcgacctctccggatcattccgag
caccgtgccgacgagccctaccggcgcgccctcatcggcatctatgcgcgcctggcggct
actgcccgcgcgctgggcgcgatcaacatcctgcgccaggaagtgggcgccgctgcgccc
tacgagacgcccgagcaatgcgtggccgagctggacgtgctggtcagttcgctgcaggcg
catcacggcgctgcgctggtcaaaccacgcctggcgggcttgaagcgcgccgtcgagatc
ttcggcttccacctggccacgctggacatgcgccagagttcggacatccacgagcgcgtg
ctggccgatctgtttgccaaggcccaggtcgaggccgactatgccgccctgaacgaggag
cgcaagatcgccctgctgctgggcgagctgtcgcgcccgcgcctgctgcattcgccctac
ctggaatattccgagcagactgattccgagctctccatcctgcgcgcggcccgcgagatc
cgccgccgctatggcgagcgcgccatccgcaactacatcatctcgcacaccgaaaccctg
tcggacctgctggaagtgctgctgctgcaaaaggaaaccggcctgctgcacatcgagggc
aaccagttgcgcgaacttgagctgatggtcattccgctgttcgagaccatccccgacctg
cgctgcgccgccgagatcatgcgcggctggctgagcctgccgcaggtcaagggcctcatc
gccaagcacggcaagctgcaggaagtcatgctgggttattcggactccaacaaggatggc
ggcttcctgacctccaactgggagctgtacaaggccgagaaccagctggtggaactgttc
aacgaagccggcgtgaagctgcgcctcttccacggtcgcggcggcaccgtcggccggggc
ggcggccccagctaccaggccatcctggcgcagccgccgggtaccgtcaacggccagatc
cgcctgaccgaacagggcgagatcatcgcctccaagttcgccaatccggagatcggccgc
cgcaacctggaactgctggtggccgccacgctggaggccagcctcatgcccaccaatgcc
gacgacaaggaagcccgcaagctggccgagttcgaacgggtcatggaagagttgtccgaa
cgcgcctatcgcgcctatcgcaacctggtctatgagaccccgggcttcaccgactacttc
tttgccgccaccccgattgccgaaatcgcgcaactgaacatcggttcgcgccccgcttcg
cgcaaggccacccagcgcatcgaagacctgcgcgccattccgtggggcttctcctggggc
cagtgccgcctgctcttccccggctggtatggctttggcagcgccgtctcgggctggctg
gaagacgccggcaatgccaaggaagcagcgcgccgcctggccacgctgcgcgccatgtgc
aaggaatggccattcttcgcggcgctgctgtcgaacatggacatggtgctctccaagacc
gacctggccgtggcctcgcgctacgctgggctggtggccgaccgcaagctgcgcaacgcc
atcttcgggcgcatcaccgacgagcacgaacgcaccagcgccatgctctccaccatcacc
ggcagcaaggagcggctggcagccaatccgctgctggcgcgctcgatcaagaaccgcttc
gcctatctcgacccgctgaaccacctgcaggtcgagctgatcaagcgtcaccgcgccacg
gtggccgccaagcgcacgccggaagaacgcgtgcagcgcggcatccacctgaccatcaat
ggcgtagccgccggcttgcgcaacaccggctag

DBGET integrated database retrieval system