KEGG   Haloquadratum walsbyi C23: Hqrw_1857Help
Entry
Hqrw_1857         CDS       T01942                                 

Gene name
glpA1
Definition
(GenBank) glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hwc  Haloquadratum walsbyi C23
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hwc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Hqrw_1857 (glpA1)
Enzymes [BR:hwc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Hqrw_1857 (glpA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
914009..915748
Genome map
AA seq 579 aa AA seqDB search
MVSKPHIVVIGGGSTGTGIVRDLAMRGVEVTLLEQGNLTHGTTGRMHGLLHSGGRYAVAD
QASAKECMLENRVLQDIATHCVEMTGGLFVKRPEDSEEYFQKKLQGCHECDIPAEVLTAE
EARAVEPHLAGDIDKAISVPDGAIDPFRLVVANAADAKEHDARIETHSTVTDLLIEDDAV
VGVEVKHDSGTGERVHGMTGVTERIYADHVINATGAWAGHIGEMAGVDIAVRPSKGVMTV
MNTRQVDTVINRCRPKGDADIVVPHETTAILGTTDVEVDDPEDYPEKQWEVDLMIDTLSE
LVPMLTDARTIRSFWGVRPLYEPPEVGSDDPTDITRDFFLLDHQERDNLHGLTSIVGGKL
TTYRMMAEQITDHICERFGIEEPCRTADEPLPGSNDIRVIDDYMDEFGLRSPIGRRSADR
LGSRVDEVFDTDEPNPTICECEGVTRAEVQDAISQSGSDLNAVRIRTRATMGNCQGGICS
HRLANELHTTYDESVVIDAWNEILQERWKGQRHALWGQQLSQAMLNYALHATTQNRDHDP
AADSSVDFTTFDSGEMQSDSGTTAVGVATDGGTQDGDRV
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggtatcaaaaccacatatcgtcgtcatcggtggcggctcgacgggcacagggatcgtt
cgtgaccttgcaatgcgtggtgttgaggtaacattactcgaacaagggaacctgacgcat
ggaacaacaggtcggatgcatggactgcttcacagtggtggtcgatatgcagtcgctgat
caagcaagtgcgaaagaatgcatgcttgagaatcgtgttcttcaggatattgctacccac
tgcgttgaaatgaccggtggattatttgttaagcgacctgaggattcagaagaatatttt
caaaagaagctacaaggatgtcatgaatgtgatattcctgcagaggtcctaaccgctgag
gaggcacgtgcggtcgaaccacacctcgcaggtgatattgataaggctatttccgtccca
gacggtgcgattgatccgtttaggcttgttgttgccaacgcggcagatgcaaaggagcat
gatgcacggattgagacacattcgacggtaactgatctcttaattgaagatgatgcagtc
gtcggtgtcgaagtaaaacatgactccggaacaggagagcgtgtccatgggatgaccggc
gtcacagagagaatctatgccgatcacgtgatcaatgcaacaggtgcgtgggctggacat
attggtgagatggcaggtgtcgatattgcggttcgtccctcaaaaggtgtgatgacggtt
atgaatacccgacaggttgatacagtcatcaatcgctgccgaccgaagggtgatgccgat
attgtcgtcccacatgaaacaacagcaatccttgggacaacagatgttgaagttgacgac
ccagaagactacccagagaaacagtgggaagtcgatttaatgatcgacacactgtcggaa
cttgtcccgatgcttacggatgcacggacaatccggtcgttctggggagtccgtccactg
tatgaaccaccagaggttgggagtgatgatccaacagacattacacgtgatttcttttta
ttagatcatcaagagcgcgataatctccatggactcacgagtattgtcggtggaaaactg
acgacataccgaatgatggctgagcaaatcaccgatcatatatgtgagcgctttggaatt
gaagaaccatgccggactgccgatgaaccattaccaggcagcaacgatattcgcgtaatt
gacgattacatggatgaattcggtcttcgctcgccgattggacgacgaagcgccgaccga
cttggatcccgtgttgatgaggtgtttgatactgatgagccaaatccaacgatctgtgag
tgtgaaggcgttacgcgcgcggaggttcaggatgcaatctcacagtctgggtcagatctt
aatgccgttcgtattcggacgcgtgcaacaatgggcaattgccaaggtgggatctgctca
caccgacttgcgaatgaacttcacacaacgtatgatgaatcagttgtcatcgatgcgtgg
aatgaaattctgcaagaacgatggaagggacagcggcacgcgctatgggggcaacaactc
tctcaagcaatgttgaattacgcattgcacgcgacaacgcagaaccgtgatcatgatcca
gctgcagacagttccgtcgattttacgacttttgactccggtgaaatgcagtctgactct
gggacgacagcggttggtgttgctacagatggaggcacacaggatggcgatcgagtctga

DBGET integrated database retrieval system