KEGG   Hydrogenophaga sp. PBC: Q5W_19005Help
Entry
Q5W_19005         CDS       T04491                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
hyb  Hydrogenophaga sp. PBC
Brite
Enzymes [BR:hyb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Q5W_19005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_N_3 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AOS80903
UniProt: A0A1C9VJI3
LinkDB All DBs
Position
complement(3995312..3996025)
Genome map
AA seq 237 aa AA seqDB search
MIDLYTAATPNGHKASIALEELGLPYTLKVLDLTAGDQKRPDFLAINPNGRIPAIVDHDA
GGFAVFESGAVLIYLAEKTGRLMPTDVKGRSRVLQWLMFQMGGVGPMMGQANVFFRYFPE
KIPAVIDRYQGETKRLFRVLDTHLKDREYLAGDYSIADIANWAWVRTHRWSGVDIDDLPH
LKRWRDAIRARPAVQRGIEMPPSKIDLTRDGDEAAQRFSQDARKLMETGQSLKGEQR
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctctacaccgccgccacgcccaatggccacaaggcctcgattgcgctcgag
gaactgggcctgccctacacgctcaaggtgctggacctcaccgccggcgatcagaagcgc
ccggacttcctcgcgatcaaccccaacggccgcatccctgcaatcgtcgaccatgacgcc
ggcggcttcgcggtgtttgaatcgggcgcggtgctgatctacctggccgagaagaccggt
cggctcatgcccaccgacgtgaagggccgctcgcgcgtgctgcagtggctgatgttccag
atgggcggggtgggcccgatgatgggccaggccaacgtgttcttccgctacttccccgag
aagatcccggccgtcatcgaccgctaccagggcgagaccaagcgcctgttccgcgtgctc
gacacgcacctgaaggaccgcgagtacctggccggcgactactccatcgccgacatcgcc
aactgggcctgggtgcgcacgcaccgctggtccggcgtggacatcgacgacctgccccac
ctcaagcgctggcgcgacgccatccgcgcacgacccgcggtgcaacgcggcatcgaaatg
ccaccgtcgaagatcgatctcacgcgcgatggcgacgaggcggcgcagcgcttctcacag
gacgcgcgcaagctgatggagaccggtcagagcctgaagggagagcagcgatga

DBGET integrated database retrieval system