KEGG   Hymenobacter sedentarius: AUC43_00355Help
Entry
AUC43_00355       CDS       T04242                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
hyg  Hymenobacter sedentarius
Pathway
hyg00052  Galactose metabolism
hyg00511  Other glycan degradation
hyg00600  Sphingolipid metabolism
hyg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hyg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AUC43_00355
  Lipid metabolism
   00600 Sphingolipid metabolism
    AUC43_00355
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AUC43_00355
Enzymes [BR:hyg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     AUC43_00355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4982 Glyco_hydro_2_C Glyco_hydro_2_N Glyco_hydro_2 BetaGal_dom4_5 DUF3344 Imm72
Motif
Other DBs
NCBI-ProteinID: ALW83688
UniProt: A0A0U4C0J4
LinkDB All DBs
Position
81206..83668
Genome map
AA seq 820 aa AA seqDB search
MPTLKTLAAALVLLATLPATAQTRQEYLLDTNWKFTKGEVADAAAPAFQDAKWQTVTVPH
DWAIYGPFDGKNDLQAVKIEQNNEQAATLKAGRTGGLPFIGTGWYRRPLAVPQFGPGRRA
VLLFDGAMSNAHVFVNGKEVGYWPYGYNSFSFDITSYLRADGNNTLAVRLQNQPESSRWY
PGAGLYRNVHLIVTDDVHIPVWGTYLTTPEITASSAQVKLKTKIETPSGAFQPLRLQTEI
RDAAGQVVATTTTALVTTNALEFEQNLTVPNPKLWSPETPVLYTAASKLYAGEVLKDEYS
TRFGIRSFKFEAGKGFSLNGKARKFRGVCNHHDLGPLGTAVNVAALRRQLALLKEMGADA
IRTSHNMPAPELVSLADEMGFMLMVEAFDEWKAPKVKNGYSQYFDEWAEKDLVNMVHRDR
NHPSVIMWSIGNEVPDQSSPNGSQIAKRLQDIVHREDPTRLVAAGMDRFDDDFKNNFAQV
LDIPGFNYKPHRYPEALGQLPQGFLLGSETASTVSSRGVYKFPVVKAKEKKYPDNQSSSY
DLESCNWSQIPDEEFVAQDDQPKVLGEFVWTGFDYLGEPTPYDEKWPSHSSYFGIIDLAG
LPKDRYYLYRARWNTTQPTLHLLPHWTWPGREGQPTPVFCYTSYPSAELFVNGKSQGRQT
KLASDRPETRYRLMWEDVKYAPGTLKVVAYDAQGNAVATEQVKTAGKPHHIRLVADRPAL
TADGRDLAFVTARVEDAQGNLCPDAAHELHFAVTGAGSFHAVANGDPTSLESFQQPQMRA
FHGQLVAVVEAGKTAGALRLQATATGLQPGTVELKTSSPK
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccctgaaaacccttgccgccgccttagtgctgctggccacccttccggccacg
gcccaaacccgacaggaatacctactggataccaactggaaattcacgaagggcgaggta
gccgatgccgccgctccagcttttcaggatgcgaaatggcaaaccgtgaccgtgccgcac
gattgggctatttacgggccttttgatggcaagaacgacctgcaggccgttaaaattgag
cagaacaacgagcaggcggcgacgctcaaagcggggcgtacgggcgggctgcccttcatc
ggcacgggctggtaccggcggccgctggcggtgccgcagtttgggcccggccggcgggcc
gtgctgctctttgacggggcgatgagcaacgcgcacgtctttgtgaacggcaaggaggtg
ggctactggccgtacggctacaactcgttttcctttgacattacctcctacctgcgggcc
gacggcaacaacacgctggccgtgcgcctgcaaaaccagccggaatcgtcgcgctggtac
cccggcgcggggctataccgcaacgtgcatttgattgtgaccgacgacgtgcacattccg
gtgtggggcacctacctgaccacgcccgaaatcaccgctagcagcgcccaggtaaagctc
aaaaccaagattgaaaccccaagtggggcattccaaccgctgcggctgcaaaccgaaatc
cgggatgcggccggccaggtggtggccaccaccaccacggcgctggtaaccactaacgcg
ttggaattcgagcaaaacctgacggtgcccaacccaaagctgtggtcgccggaaacgccg
gtgctgtacacggccgcctcgaagctgtatgccggcgaggtgctgaaagacgagtatagc
acccggttcggcattcgctcgttcaagtttgaggcgggcaaagggttttcgctgaatggc
aaggcccgcaagtttcggggcgtgtgcaaccaccacgatttgggcccgctgggcaccgcc
gtgaacgtggccgccctgcgccgccagctggccttgctcaaggaaatgggcgccgatgcc
atccgcacctcgcacaacatgccggcgcccgagctggtgagcctggccgacgaaatgggc
tttatgctgatggtagaggcctttgatgagtggaaagcgccaaaagtgaagaacggctac
agccaatacttcgacgagtgggctgaaaaagacctggtgaacatggtgcaccgcgaccgc
aaccacccctcggtcatcatgtggagcattggtaacgaggtgcccgaccaaagcagcccc
aacggtagccagattgccaagcgcctgcaggacatcgtgcaccgcgaggaccccacgcgc
ctcgtggccgcgggcatggaccgcttcgacgacgacttcaaaaacaactttgcgcaggtg
ctcgacatccccggcttcaactacaagccgcaccgctacccggaagcgctgggccagctg
ccgcagggcttcctgctgggttccgaaaccgcctccacagtcagcagccgcggggtgtac
aagtttccggtggtgaaggccaaggagaagaagtatcccgacaaccagtcgtcgtcgtac
gacctggaatcctgcaactggtcgcaaattcccgacgaggaatttgtggcgcaggacgac
cagcccaaagtgctgggtgagtttgtgtggaccggcttcgactacctgggcgagcccacg
ccctacgacgaaaagtggccctcccacagctcctacttcggcatcattgacctggccggc
ctgcccaaggaccgctactacctctaccgcgcccgctggaatacaactcaacctacgctg
cacctgctcccgcactggacctggcccggccgcgaaggccagcctacgccggtgttctgc
tacaccagctacccgtcggctgagctgtttgtgaacggcaaaagccaggggcgccagacc
aagctggcctccgaccggcccgaaacgcgctaccgcctgatgtgggaagacgtgaagtat
gcccccggcacgctcaaggtagtggcctacgatgcccagggcaacgccgtggccaccgag
caggtgaagactgccggcaagccccaccacatccgcctggtggccgaccgcccagccctg
accgccgacggccgggacctggccttcgtgacggcccgcgtggaagacgcgcaaggcaac
ctctgccccgatgccgcccatgaactgcactttgccgtgacgggcgcgggcagcttccac
gccgtagccaacggcgacccgacgagcctggagtcattccagcagccccagatgcgggct
ttccatggccaactggtggccgtagtggaggctggcaaaaccgccggtgccctgcggctg
caggccacggccaccggcctgcaacccggcaccgtggagctgaaaacgagcagccccaaa
taa

DBGET integrated database retrieval system