KEGG   Hydrogenophaga sp. LPB0072: LPB072_01125Help
Entry
LPB072_01125      CDS       T04505                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
hyl  Hydrogenophaga sp. LPB0072
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hyl00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    LPB072_01125
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    LPB072_01125
Enzymes [BR:hyl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     LPB072_01125
Peptidoglycan biosynthesis and degradation proteins [BR:hyl01011]
 Precursor biosynthesis
  Racemase
   LPB072_01125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(226207..227331)
Genome map
AA seq 374 aa AA seqDB search
MPRPILATVHSAALRHNLNQARLRAPDAKVWAVVKANAYGHGIERAFEGLRSADGFAMLD
FDEAQRIRALDWRGPILMLEGVFEPRDLELCSRLGLWHTVHCTEQLDWLAAHKTQAPHRV
FLKLNSGMNRLGFAPTAFRAAWARLNALPQVEEISLMTHFSDADGPRGIAHQVAAFETVT
ADLPGERTLCNSAAILRHAGSPLRGEGAVTTLAADWVREGIALYGSAPDHPENTAATWGL
TSAMTLSTRVIGVQSLQAGDTVGYGSAFTADGPMRVGVIACGYADGYPRHAPTGTPVLIN
GIRTRIVGRVSMDMVTVDLTHLDASVGVGAEVICWGESPSTGAVLPVDEVAEAAGTIAYE
LLCAVAQRVPFLVV
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtccgattcttgccaccgttcactccgccgccctgcgccacaacctgaaccag
gcccgtctgcgcgcaccggacgcgaaggtttgggccgtggtcaaagccaacgcctatggt
cacggcatcgagcgcgcgttcgagggtttgcgcagcgccgacggctttgccatgctcgat
ttcgacgaagcccagcgcattcgcgcgctggactggcgtggcccgatactgatgctcgag
ggcgtctttgagccccgcgatctggagttgtgttcgcggctgggtctttggcacacggtg
cattgcaccgaacagctcgactggctggcagcccataaaacgcaggcgccacaccgcgtt
tttctcaagctcaacagcggcatgaacaggctgggctttgcgcccaccgcctttcgcgcc
gcctgggcgcggctcaacgctttgccacaggtggaagagatttccctcatgacgcacttc
agcgacgccgacggtccccggggcatcgcccaccaggtggcggcgttcgaaaccgtcaca
gccgacttgccgggggagcgcacgctgtgcaacagcgcggcgatcctgcgccacgccggc
agcccattgcgtggcgaaggcgcagtcaccaccctggcggccgactgggtgcgcgaaggc
attgcgctctacggcagcgcgcccgaccacccggagaacaccgctgccacatgggggctg
acgtccgccatgacgctttcaacccgcgtgatcggcgtgcaatcgctgcaggccggcgac
accgtggggtacggctcggcgttcacggccgatggtccaatgcgcgtgggcgtgattgcc
tgtggctacgccgatggctatccgcgccacgcaccaaccggcacaccggtattgatcaac
ggcattcgcacccgaatcgtggggcgggtgagcatggacatggtcacggtcgacctcaca
cacctcgatgcctcggtcggggtcggcgcagaggtgatttgctggggtgaatcgccctcc
acaggcgcggtgttgcccgtggacgaggtggctgaagccgccgggacgattgcctacgag
ttgctgtgtgcggtcgcgcaaagggtgcctttcttggtggtttga

DBGET integrated database retrieval system