KEGG   Hydrogenophaga sp. LPB0072: LPB072_18325Help
Entry
LPB072_18325      CDS       T04505                                 

Definition
(GenBank) ribulose-bisphosphate carboxylase large subunit
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
hyl  Hydrogenophaga sp. LPB0072
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:hyl00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    LPB072_18325
Enzymes [BR:hyl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     LPB072_18325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3968207..3969628)
Genome map
AA seq 473 aa AA seqDB search
MATKTYNAGVKEYRSTYWEPQYAVKDTDILACFKITPQPGVSREEVAAAVAAESSTGTWT
TVWTDLLTDLDFYKGRAYRIEDVPGDDTCFYAFVAYPIDLFEEGSIVNVLTSLVGNVFGF
KALRALRLEDIRFPIAYVKTCGGPPAGIQVERDRFNKYGRPLLGCTIKPKLGLSAKNYGR
AVYECLRGGLDLTKDDENVNSQSFMRWRDRFEFVVEGCQKAERETGERKGHYLNVTSPTV
EEMFKRAEFAKELGAPIIMHDFLTGGFTANTSLANWCRNNGMLLHIHRAMHAVLDRNPHH
GIHFRVLTKCLRLSGGDHLHSGTVVGKLEGDREATLGWIDLMRERFIKEDRSRGIFFDQD
FGSMPGVFPVASGGIHVWHMPALVNIFGDDSCLQFGGGTLGHPWGNAAGACANRVAVEAC
VKARNEGVEVEKEGKTVLMDAAKHSPELKIAMETWKEIKFEFDTVDKLDVAHK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggccacgaaaacctacaacgccggtgtcaaggaataccgcagcacctactgggagcct
cagtacgccgtcaaggacaccgacatcctggcgtgtttcaaaatcacgcctcagcccggt
gtgtcgcgcgaagaagttgccgctgccgtggccgccgagtcgtccaccgggacctggacc
acggtctggaccgacctgctgaccgacctggatttttacaaaggccgcgcctaccgcatc
gaagacgtacccggcgatgacacctgcttttacgccttcgtggcctatccgatcgacctg
ttcgaagaaggctccatcgtcaacgtgctgacgtcgctggttggcaatgtgtttggtttc
aaggccttgcgcgccttgcgtctggaagacattcgattccccattgcttatgtgaagacc
tgcggtggtccaccagcgggcatccaggtggagcgcgaccgcttcaacaaatacggtcgg
ccgctgctgggttgcacgatcaagcccaagctggggctgtcggccaagaactacggccgc
gcggtgtacgagtgcctgcgtggcggtctggacctgaccaaggacgacgagaacgtcaac
agccagtccttcatgcgttggcgcgaccggttcgagttcgttgtggagggctgccagaag
gccgaacgcgagaccggtgagcgcaagggtcactacctgaatgtgacctcgccaaccgtg
gaagagatgttcaagcgcgctgagttcgccaaggaactgggtgcgccgatcatcatgcac
gacttcctcaccggaggcttcaccgccaacaccagcctggccaactggtgtcgcaacaac
ggcatgctgctgcacatccaccgcgccatgcacgccgtgctcgaccgcaacccgcaccac
ggcatccacttccgtgtgctgaccaagtgcctgcgcctctcgggcggtgaccacctgcac
tccggcacggtggtgggcaagctggaaggcgaccgcgaagccacactgggctggatcgac
ctgatgcgcgaacggttcatcaaggaagaccgctcacgcggcatctttttcgaccaggat
tttggttccatgcccggcgtcttcccggtcgcctcgggtggcattcacgtgtggcacatg
cccgcattggtcaacatcttcggtgacgactcctgcctgcagtttggtggcggcacgctg
ggccacccctggggcaatgcggcgggcgcctgcgccaaccgcgtcgcagtggaagcctgc
gtcaaggcccgcaacgagggcgtggaagtcgagaaggaaggcaagaccgtgttgatggat
gccgccaaacattcgcccgaactgaaaatcgccatggaaacctggaaagagatcaagttc
gagttcgacaccgtagacaagctcgacgtcgcccacaagtga

DBGET integrated database retrieval system