KEGG   Hymenobacter sp. APR13: N008_19665Help
Entry
N008_19665        CDS       T03213                                 

Definition
(GenBank) hypothetical protein
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
hym  Hymenobacter sp. APR13
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hym00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    N008_19665
Enzymes [BR:hym01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     N008_19665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4577964..4579595
Genome map
AA seq 543 aa AA seqDB search
MPISSTQGTWWQVLGSRAAELKAAGITALWLPPAYKGGSQSDVGYGVYDRYDLGEFNQKG
TVATRYGTLGQLQTAIGAMKGQGLQVYEDMVMNHMTWADAQENVNGNLVYTKFNFPGRGN
TYSSYKWTFNNFTGTQQAPNNGWYQWKSWDFQPYANNDAYDNLLGSEIQYNNNAANQTET
INWGNWITTKMSLDGYRLDATKHIYTPYVNQWLDAVKTNGRFAVSEAWFRNLQDLKNYAA
ATGGRTSLFDVPLHYTFQDMSNGNGAWDMRGLQFAGFTESNPTLSVSFVDNHDTDHPGAL
YSPVTNLKMLAYAYILTRANGYPCVFYKDYYNYGLGNQIKTLNGIRQANAYGAAAEYTSI
NDADVYVYSRAGDATHKGLLMLLNDGSTARTKTVTTPFKNATLTDKTGNRTGTVTTDANG
TGNFPVNARSYSVWVPGGTVTTPPSTTTTAVSFNVTYSGTVSGQDVYVLGSTAQLGAWNT
ANAIKLSGATYPVWKGTINLTSGTSVQYKYIRKDAAGNVLYEGGANRTFTPTGTSQTRTE
TWQ
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
gtgccgatcagcagcacgcagggcacttggtggcaggtgctgggctcccgggccgccgag
ctgaaggctgccggcattactgccctttggctcccgccggcctacaaaggcggcagccag
agcgacgtcggctacggcgtgtatgaccgctacgacctgggcgagttcaaccagaaaggc
accgtggccacgcgctatggcaccctcgggcagctgcagaccgctattggggccatgaag
ggccagggcctgcaggtgtacgaggacatggtgatgaaccacatgacctgggccgacgcc
caggaaaacgtgaacggcaacctggtgtacaccaagttcaacttccccggccgcggcaac
acctacagcagctacaagtggaccttcaacaacttcaccggcacgcagcaggcgcctaac
aacggctggtaccagtggaaaagctgggacttccagccctacgccaacaacgacgcctac
gacaacctgctgggctcggaaatccagtacaacaacaacgcggccaaccagaccgagacc
atcaactggggcaactggattaccaccaagatgagcctcgacggctaccgcctcgatgcc
accaagcacatctacacgccctacgtgaaccagtggctggacgcggtgaaaaccaacggc
cgctttgccgtttcggaggcctggttccgcaacctgcaggacctgaagaactacgccgcc
gccaccgggggccgcaccagcctcttcgacgtgccgctgcactacaccttccaggatatg
agcaacggcaacggcgcctgggacatgcgtgggctgcagttcgccggtttcaccgagagc
aaccccacgctgtcggtgagcttcgtggataaccacgataccgaccaccccggcgccctg
tactcgcccgtgaccaacctgaagatgctggcctacgcctacatcctgacccgcgccaac
ggctacccctgcgtgttctacaaggactactacaactacggcctcggcaaccagatcaag
accctgaacggtatccgccaagccaacgcctacggggccgccgccgagtacaccagcatc
aacgacgccgacgtgtacgtgtactcccgcgccggcgacgccacgcacaaaggcctgctg
atgctgctcaacgacggcagcacggcccgcaccaaaacggtgaccacgcctttcaaaaac
gctaccctcaccgacaagaccggcaaccgcaccggcaccgtaaccaccgatgccaacggc
accggcaacttcccggtgaatgcccgcagctactcggtgtgggtgcccggcggcaccgtc
acgacgcctccctccaccactaccacggccgtatcgtttaacgtgacgtacagcggtacc
gtatcggggcaggacgtgtacgtgctgggcagcaccgcccagctcggcgcctggaacacg
gccaacgccatcaaactcagcggcgctacctaccccgtgtggaaaggcaccatcaacctg
accagcggcaccagcgtgcagtacaagtacatccgcaaggatgccgccggcaacgtgctc
tatgaaggcggcgccaaccgcaccttcacgcccaccggcaccagccagacgcgcaccgaa
acgtggcagtaa

DBGET integrated database retrieval system