Hydrogenophaga sp. RAC07: BSY239_397 Help Entry BSY239_397        CDS       T04455                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism hyr  Hydrogenophaga sp. RAC07 Brite KEGG Orthology (KO) [BR:hyr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hyr03036]     BSY239_397 (ftsL) Chromosome and associated proteins [BR:hyr03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     BSY239_397 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC DUF2681 Motif Other DBs NCBI-ProteinID:  AOF86649 UniProt:  A0A1B3M0K6 LinkDB All DBs Position 440134..440430 Genome browser AA seq 98 aa AA seqDB search MIRLNLVLLLAVIASAFYLVHTQYESRRLYAALDRSQAQTRKLDAEHEQLQVQKRAQATP ARVQQLATRQLQMRPVTPGVTQYVTVFEPSVPAEAAAK NT seq 297 nt NT seq  +upstreamnt  +downstreamnt gtgatcagactcaatcttgtgttgctgctcgccgtgatcgccagcgccttctacctggtg cacacgcagtacgagtcgcgtcgtctctatgccgcgctcgaccgctcgcaggcgcagaca cgcaagctcgatgccgaacacgagcagctgcaggtgcaaaaacgcgcgcaggccacaccc gcgcgtgtgcagcagctggccacgcgccagttgcagatgcgcccggtcacgccgggtgtg acgcagtacgtgacggtgttcgagccttcggtgcctgcggaggccgccgccaaatga

DBGET integrated database retrieval system