KEGG   Intestinimonas butyriciproducens: IB211_03259cHelp
Entry
IB211_03259c      CDS       T04182                                 

Definition
(GenBank) Sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
ibu  Intestinimonas butyriciproducens
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ibu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    IB211_03259c
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    IB211_03259c
Enzymes [BR:ibu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     IB211_03259c
Bacterial toxins [BR:ibu02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   IB211_03259c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3247451..3250249)
Genome map
AA seq 932 aa AA seqDB search
MLDRAAANGFCYRYDGDDQVFDGSRIVNGTAQDISRLKASVQGTLLIRYQSAAAANQVLF
AAGKDTAVGHYGAVLANKVPAVNLQRIDFPDGMVANLSGTAVGQDWHTFVYSVDASDPEV
KTAKTVTSFDGSATTQFPNYASWFNQNADVNDIQFLNIGGTSGALANSNNNANFVGRIAF
VAFLPEVFTQAEAAALSSETWPPSAVPVYSAQNITINSAADAVELSSALVDTLKGLHNAS
IIVKYQNTNTGVGSFFSISDPTKVNAHFHVYESGNTFGFELRNSDNPKYSGTCRVYGGEL
NTVAFKAEAGVGYKLFANGALGSTVSKTGTDYLFLDGMSGLTTAFVGKLKRSNDQNSYPF
TGTIESIEIYATALTDEELIDRTKDTARESNAIFFNGDATGSTFFRIPFLLAASDGTLIA
GTDANFGSTGDSAENIDAAIRIKPNAAAHDIMEGWLDASVPDVLHMRDYADEYGYKQKSA
SFIDGVIVEDTVHTDRVLLLIDAFAWNGGGFQWLNVDQYGQAHGGTARSVALGDGFCTIG
GQKYLLLSDQNIKSGNINMNVDRSKFNYAADIYGAKNADGRYNVYHLTGTPLPYTSSGTP
VDDSGLSLGALSEYSLGENYELYKDGTALTVTQKSSDATAPSVSVPMKIFYEDSELQVYN
TNYIMQLYSTDSGRTWHTDKLITGMVKREESHYYLTGPGHGIQLQHGEHAGRLVVPIYFQ
GEGGGGLTGSAHTEVIYSDDGGVTWAHGEPLPNTLGHESVIVELPNGNLQIFMRNTASSG
GKCKTATSLDGGLTWVEVHSTFGDNSAGTNSQLSAIAYSQDVVSAKDGQSYPAVLLSMAY
NRSRTDGRIYVGLLKENGTYDNGSTKYEIDWEYKYQVTAADELFAYSSMVELSNGKVGMI
YEASPTNSWADGLQYMYYGEYDIDSLTSQPLQ
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
gtgctggaccgcgctgcagccaacggcttctgttaccgctatgatggcgacgatcaggtt
ttcgacggcagccgtatcgtcaatggtacagcacaggacatctcccgtctaaaagcaagc
gtccagggtacgctgctgattcgttatcagagcgcggctgctgcgaaccaggtcctcttt
gccgcaggaaaagataccgctgtggggcactatggcgcggtattggcaaataaagtgccg
gcggtaaaccttcaacggatcgatttccctgacggtatggtggcaaatctctctggaacg
gcagtcggtcaggactggcacacctttgtttacagcgttgatgcttccgacccggaggta
aagacagccaagaccgtgaccagcttcgatggaagtgctactacgcaatttcccaactat
gcttcctggttcaaccaaaacgctgatgtcaacgacattcagtttttgaacatcggcggt
acctccggtgcgctggcaaactccaataataacgcgaatttcgtgggcaggattgctttc
gtggctttcctcccagaggtgtttacgcaggctgaggcggccgcgctcagcagcgaaacc
tggccgccctccgcagtgcctgtctattcagctcaaaatatcacgatcaacagcgccgca
gatgcagtagagcttagctccgcactggtagatacgctgaaaggcctccacaatgccagc
ataattgtaaaataccagaataccaatacaggagtgggctcttttttcagcatcagcgac
cccaccaaggtaaacgcccatttccatgtttatgagagcggaaatacctttggcttcgag
ttgcgcaacagtgataacccgaagtattctggtacatgcagggtgtacggtggagaactc
aataccgttgcttttaaggcggaggccggcgtaggatacaagctgtttgcaaacggcgca
ttgggcagtactgtttccaagaccggaacggactacctcttcctggacggcatgagcgga
ttgactacagctttcgtgggcaagctgaagcgatccaacgaccagaacagctaccccttc
accggcaccattgaatccattgaaatctacgctacagctctgacagatgaggaactgatt
gaccgcacgaaggacacagcccgggaatccaacgcgatcttcttcaacggagatgctacc
ggctccacgttcttccgtattcctttcctgcttgccgcctccgatggaaccttgattgcg
ggtacagacgccaacttcggcagtaccggcgacagcgcggaaaatatcgacgcggcgatt
cgtattaaaccgaatgccgccgcccatgacatcatggaaggatggctggacgcctctgtg
cctgacgtgctccacatgagggactacgctgatgagtacggatataaacagaagtccgcc
tctttcatcgacggcgtgattgttgaggatacagtccacacagaccgcgttctgctcctc
attgacgcctttgcctggaatggcggcggattccaatggctcaatgtagatcagtatggt
caagcccatggcggcactgccagaagcgttgcccttggcgacggcttctgcaccattggc
ggccagaagtatctgctcctctccgaccagaatatcaagtccggcaatatcaatatgaat
gtggatcgcagcaagtttaactatgcagccgacatatatggggccaaaaatgcggacggg
cgctataatgtctaccaccttaccggtacgccgttgccctacacttccagcggtacaccg
gtggatgacagcgggctctccctgggtgcgctttctgagtatagcctgggggaaaattac
gaactctataaggatgggacggctctgaccgttacgcaaaaatcctctgacgccactgct
ccatccgtctctgttccaatgaaaattttctacgaggactcggagctccaagtctacaac
accaactacatcatgcaactttattcgacggacagcggtcggacttggcacacggacaag
cttatcacgggtatggtcaagagagaagaatcccactactacctcactgggccgggccac
ggtatccaactccagcacggtgagcatgcgggccggctggtcgtgcccatttacttccag
ggcgaaggcggtggcgggctcaccggatctgctcacacggaagtcatttacagtgacgac
ggcggcgtgacctgggcacatggggaaccgctgccgaatacactggggcacgaatcggtc
attgtagagctccccaacggcaacctgcaaatttttatgcgcaataccgcatcttcgggc
ggtaagtgtaagacggctaccagcctggacgggggcctcacttgggttgaggtccactcc
accttcggcgataacagcgccgggaccaacagccagctatccgccatcgcatacagccaa
gacgtggtgtccgcaaaggacggccaatcttatccggcagtccttctgtccatggcttac
aacaggagcaggaccgatggacgcatctatgtagggctgcttaaggaaaacggtacttat
gataacgggagcaccaagtatgaaattgattgggagtacaagtatcaggtcacggcagcc
gatgagctttttgcatacagtagcatggtagaactctctaatggcaaagtcggcatgatc
tatgaggcatccccaaccaattcctgggcggatggactacagtatatgtactatggcgaa
tacgacatcgatagcttaacaagccagcctctgcagtaa

DBGET integrated database retrieval system