KEGG   Intrasporangium calvum: Intca_0420Help
Entry
Intca_0420        CDS       T01385                                 

Definition
(GenBank) coagulation factor 5/8 type domain protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
ica  Intrasporangium calvum
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Intca_0420
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Intca_0420
Enzymes [BR:ica01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Intca_0420
Bacterial toxins [BR:ica02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Intca_0420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
453823..456300
Genome map
AA seq 825 aa AA seqDB search
MHTRRAALAGLALTVSIPLTVPLSVPVAMAGAAAATAADQTGITRTDLDHTGDGYPVYRI
PALTKTTDGTLVAAYDGRPSYGDVPNNIALVVRRSTDDGSTWEDRQVVRYEAGKPGFGDP
SLVTDRVTGRIWLFHAASVNQGYFGSTTGTDDADPNVLHADVSWSDDDGLTWQHRRLTSE
VKDPQWGGLFAASGEGIQIRRGPHQGRLVQQYAIRYQGGNWAASLISDDHGETWRFGDLL
GPGMDENKVVELSDGRLMLNSRAPGGYRKVAYSSDGGETWSGLHADDELVDPQNNGSIIR
YDADAAPSSPDAAKLLFSNTATQSGRRNLTIRQSCDNGETWPIRKVVEPGAAEYSTLTPL
GDQQFGLLYERGGYQHISFARFGGDWLDGVCAPLTSRTVTAGSPGGTAEVEVKVTSQETG
AIDGGRVALDLPSGFTAPEVPVAKLSRGATATVRIPVRMPEGAVTNAYPYTARFLSDKGS
SQSGGSIVVKGGNVVLSDSTERSYDGATITDLTDRVDAVKDLTGGAVTVRFSTTARPAVG
TLLSLADPISAVRDVIVSLNGGRPYVEVRTATSTYPIRLQSSVDVADGKVHELIAASNAG
VTSLILDDAVIAQVDGQGFFADVTALTRPHTLNPSGKPNLTLGMNRGHFSVNGGPAAPNS
RWGFVGTIHSVEVSDDLRTGEELVPAAGLSIASVSSEETAGEDGRAANAVDGNPATIWHS
KWTGTAAEYPHQITVDLGQAQPLTALRYLRRAVGTNGDIADHVVSVSDDNVSWTQVATGT
FAATKGEEEVRFAPQTARYVRLEALSAVNGLQFAAAAELRPVRTS
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgcacacccgacgcgcggccctcgcgggcctcgccctcaccgtgtccatccccctgacc
gtccccttgagcgtccccgtggcgatggccggggcagccgccgccaccgccgcggaccaa
actggcatcacccgcaccgacctcgaccacaccggcgacggctaccccgtctaccgcatt
cccgcgctgacgaagacgaccgacgggacgctcgtggcggcttatgacggccgccccagc
tatggagacgtcccgaacaacatcgcgctcgtcgttcgtcgcagcaccgacgacggctcg
acgtgggaggaccggcaggtggttcgctacgaggccggcaagccgggcttcggtgacccc
agcctcgtcaccgaccgggtgacgggccggatctggctgttccacgccgcctccgtcaac
cagggctacttcgggtccacgaccggcaccgacgacgccgaccccaatgtgctccacgcc
gacgtcagctggtccgacgacgacggcctgacgtggcagcaccggcggctcacgagcgag
gtcaaggacccgcagtggggcggcctcttcgccgcctccggcgagggcatccagatccgg
cgcggcccgcaccaggggcgactcgtccagcagtacgccatccggtaccagggcggcaac
tgggcggccagcctcatcagtgacgaccacggcgagacgtggcgcttcggggacctgctc
ggccccggcatggacgagaacaaggtggtcgagctctcggacgggcggctcatgctcaac
tctcgggcgcccggcggataccgcaaggtcgcctactcgagcgacggcggcgagacgtgg
tcggggctgcacgccgacgacgagctggtcgacccgcagaacaacgggtcgatcatccgc
tacgacgcggacgcggccccgagctcaccggacgccgccaagctcctcttcagcaacacg
gcgacgcagagcggccgccgcaacctgacgatccgacagtcgtgcgacaacggggagacc
tggccgatccgcaaggtcgtcgagccgggcgccgccgagtactccaccctcacgcccttg
ggagaccagcagttcggcctgctctacgagcggggtggctaccagcacatcagcttcgcg
cggttcggtggcgactggctcgacggcgtctgcgcgccgctcacgagccgcacggtcacg
gcgggctccccgggcggaaccgccgaggtcgaggtgaaggtgacgagccaggagaccggt
gccatcgacggaggcagggtggccctcgacctgccgtcgggcttcaccgcgcccgaggtc
ccggtcgcgaagctgagccgcggggccacggcgacggtgcggatcccggtccggatgccc
gagggagcggtgaccaacgcctacccgtacaccgcccggttcctcagcgacaagggttcc
tcccagagcggcgggagcatcgtggtcaagggcggcaacgtcgtcctcagcgactcgacc
gagcgcagctacgacggagcgacgatcacggacctcaccgaccgggtcgacgcggtgaag
gacctcaccggcggcgccgtgaccgtgcgcttcagcacgacggcccgccccgccgtgggc
acgctcctgtccctggccgaccccatcagcgccgtccgtgacgtcatcgtctcgctcaac
ggtgggcggccctacgtcgaggtgcgcaccgcgacgagcacctacccgatccggctgcag
agcagtgtcgacgtcgccgacggcaaggttcacgagctcatcgcggcgagcaacgccggg
gtcacctcgctgatcctcgacgatgccgtcatcgcccaggtcgacggtcaggggttcttc
gccgacgtcacggccctgacccgcccgcacaccctcaacccgagcggcaagccgaacctc
accctcggcatgaaccgcggtcacttctccgtcaacggcggccccgctgcgccgaacagc
cgctggggcttcgtcggcacgatccacagcgtcgaggtctccgacgacctgcggaccggc
gaggagctggtcccggccgccggactctcgatcgcctcggtctccagcgaggagaccgcc
ggtgaggacggtcgcgccgccaacgccgtcgacggcaacccagcgacgatctggcactcg
aagtggaccggcaccgcggccgagtacccgcaccagatcaccgtggacctcggccaggcg
cagcccctcaccgcgctgcgctacctgcggcgcgccgtcgggacgaacggcgacatcgcc
gaccacgtcgtctcggtgagcgacgacaacgtctcgtggacccaggttgcgacgggcacg
ttcgccgcgacgaagggtgaggaggaggtccgcttcgcaccccaaacggcgcgctacgtg
cggctcgaggcgctcagtgccgtcaacggactgcagttcgccgcggccgccgagctccgc
cccgtccgcaccagctga

DBGET integrated database retrieval system