KEGG   Intrasporangium calvum: Intca_0627Help
Entry
Intca_0627        CDS       T01385                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain protein
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ica  Intrasporangium calvum
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ica00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Intca_0627
Enzymes [BR:ica01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Intca_0627
DNA repair and recombination proteins [BR:ica03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Intca_0627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
686491..687402
Genome map
AA seq 303 aa AA seqDB search
MPGRQRNENGEKVAVEVEGRRMRLSSLEKVMFPATGTTKAQVIDYYARIAPVLLPHLADR
PVTRIRYPHGVGDLQFFEKNVPAGVPEWIRRAGRDPVFPFIDDLAGLTFFANLNSLELHV
PQWRFEGEGPDAVPRNPDRLVIDLDPGPGTGLREVSGVAVIVRDRLADIGLATVPVTSGS
KGMQLYARLPGGAHSSDQIRDTVQQLAQELTKRHPDRIVWKMAKDLRPGKIFLDWSQNVA
AKTTVCPYSLRGREAPTVAAPRTWAEVEAGAAGEELRQLWFNEVLDRVAAHGDLAVEIAA
PAT
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccgggccggcagcggaacgagaacggcgagaaggtggccgtcgaggtcgagggccgg
cggatgcggctgagcagcctggaaaaggtgatgtttccagcgaccgggacgacaaaggcg
caggtcatcgactattacgcgcggatcgccccggtgctgttgccccacttggccgaccgg
ccggtgacccgaattcggtatccgcacggggtcggcgacctccagttcttcgagaagaac
gtgccggcaggggtccccgagtggattcggcgggccgggcgagacccggtgttccccttc
atcgacgacctggcggggctcaccttcttcgcgaatctcaactcgctcgagctccacgtg
ccgcaatggcgtttcgaaggtgaaggccctgacgccgttccccgcaaccccgaccggctc
gtgatcgacctggatccggggcccgggaccgggctgcgggaggtctcgggggtcgctgtg
atcgtccgggaccggctggcggacatcggtctggcgaccgtgcccgtgacgagcgggagc
aagggcatgcaactgtacgcacggctgcccgggggcgcccactcgagcgaccagatccgg
gacaccgtgcagcagctggctcaggagctgaccaagcggcatccggaccgcatcgtctgg
aagatggccaaggacctgcggcccggcaagatcttcctcgactggagccagaacgtggcg
gcgaagacgacggtctgcccgtactcgctccgagggcgcgaggcccccacggtcgccgcc
ccgcggacctgggcggaggtcgaggcgggcgccgcgggtgaggagctgcgacagctgtgg
ttcaacgaggtgctcgaccgggtcgcggcgcacggggacctggcggtggagatcgccgcg
ccggccacctga

DBGET integrated database retrieval system